KEGG   Drosophila virilis: Dvir_GJ18146Help
Entry
Dvir_GJ18146      CDS       T01066                                 

Definition
GJ18146 gene product from transcript GJ18146-RA
Orthology
K03099  
son of sevenless
Organism
dvi  Drosophila virilis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ18146
   04630 Jak-STAT signaling pathway
    Dvir_GJ18146
   04068 FoxO signaling pathway
    Dvir_GJ18146
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dvir_GJ18146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1597 aa AA seqDB search
MFSSVGSHGISVGIASTVHDTDGYDFTKNENAARWRGLFVPSLRKVLEQVNPRVTAKEDA
LLYVENLCVRLLAKLCAQPLPHSVQDVEEKVNKSPLDRWALKEANEVINSKKRKCLLPTE
RVHTLLQKDVLQYKIDSSVSAYLVAVLECISSDILKMAADYVCNIAHSEIVKEDIEVVLN
ADGVLLDMLNRSSEQLKCNVLPSPLSLQAQRASATYEETVKELINDEKQYQRDLHMIIRV
FREELVKIARDPKELEPIFSNIMDIYEVTVTLLGSLEDVIEMSQEQNAPCVASCFEELAE
AEEFDVYKKYAHDVTSQASRDALSNLLAKPDALSLMSAGHGFREAVKYYLPKLLLVPICH
AFVYFDYIKHLMDLSTSQDDIESFAQVQGLLHPLHCDLEKVMANLSKERLVPVSGRVRRQ
MAIERTRELQLKVEHWDDKDVGLNCNEFIREDALSKLGSGKRIWSERKVFLFDGLMVLCK
ANTKKQTPSAGATAYDYRLKEKFFMRRVEINDRADTEELKHSFELITRMHPAIVLSAKNA
QHKNDWMADLIMVNTKSMLDRILDSILQDIERKHPLRMPSPEIYKFAVPDSAENIVLEER
DSGVVPMIKGATLCKLIERLTYHIYADPTFVRTFLTTYRYFCSPQQLLTLLIERFEIPEP
SLVYQEQQTNNIGGGGGNSDLDKDAATATASTADSDKMLKNSQREDWKRYRKEFVQPVQF
RVLNVLRHWVDHHFYDFEKDPTLLDRLLHFLNDVNSKSMRKWVDSVRKIVDRKNKQSNKK
IVYAYGHDPPPIEYHLNVPDDEITLLTLHPLEVARQLTLLEFEMYKNVKPSELVGSPWTK
KDKELKSPNLLKIMKHTTNVTRWIERSIMEAENYDERLAIMQRAIEVMMVMLELNNFNGI
LSIVAAMGTAAVFRLRATFNGLPERHRKFLDECRELSEDHLKKYQERLRSINPPCVPFFG
RYLTNILHLEEGNPDLLTNTELINFSKRRKVSEIIGEIQQYQNQPYCLNEEPTIRHFFEQ
LDPFNGLSDKEMSDYLYNESLRIEPRACKTVPKFPRKWPNIPLKSPGIKPRRQNQNNNSN
KLSSNAPASVEPPAAAAAASSTASTTATSIGDQSPQHNPHAYSVFAPVIIPERNGGSSWS
SHTMHRTTDNGEVAPAPHLPRKPAAHVWTHNSNAPTDGFSPAEQQLPPPATSAAATSSWN
MSDCYVISDANTAEVLPPSPLPKLMISPRHETAPPPPPPASNRSPFHGRIQQMQYSPTHS
IASTVTLISGGFGDVSPQLGGFYYNSEQGHGQTGAVPISPHVNVPTATTLEYRAVPPPLP
PRRKERTESCADMAQKRQAPDAPTLPPRDGELSPPPIPPRLNHSTATGFTRQPKEFVGKS
SSLLLPNTSSIMIRRNSAKQPSLGVSTSTATANNSAAATPMMAHSVAMAGSEEPQQQQQL
QQPPQSISPALSSSTTTSPMTPMTPMSPYIPSTVDGSTTSSFPQQQQQQHQHQTRLRPQT
AQTQQPVAYAQQHQHHHQHQHQQHHSHSHPHTHTHAHSQHQHPSQHPNRRSSPKEFFPIA
TSHEGTPKLPPKPSLSANFYNNPDKGTMFLYPSTNQE
NT seq 4794 nt NT seq  +upstreamnt  +downstreamnt
atgttttccagcgttggcagccatgggattagcgttggcattgcctccaccgtgcatgac
accgatggctatgattttacgaaaaacgagaatgcggcacgttggcgcggcctttttgta
ccatcactgcgcaaggtgctggagcaggtgaatccgcgcgtaacagccaaagaagatgcc
ctgctctacgtggaaaatctatgcgtccgcctcttggccaaattgtgcgcgcagccattg
ccacactcagtgcaggatgtggaggaaaaggtgaacaaatcaccgcttgatcgttgggcc
ctcaaggaggccaacgaggtgatcaattccaagaagcgcaaatgtttactgcccacggag
cgtgttcatacgctgctgcagaaagatgtgctgcaatataagatcgatagctccgtatcg
gcatatttggtcgctgtgctcgagtgcatctcatcggatatactgaaaatggctgcggat
tatgtttgcaacatcgcgcatagcgaaatcgtgaaggaggatattgaggtggttctcaat
gcggatggtgtccttctcgatatgctcaatcgtagcagcgagcagctcaagtgtaatgtc
ctgcccagtccgctgtctctgcaggcgcagcgtgcgagcgccacgtacgaggagacagta
aaggagctgatcaatgatgaaaaacaatatcaacgggatttgcatatgattatacgggta
tttcgcgaagagctggtcaagatagcgcgcgatcccaaggagctagagccgatcttctca
aacataatggatatatatgaggttacggtaacgcttctgggctctctggaggatgttatt
gaaatgtcgcaggaacagaatgccccttgcgttgccagctgctttgaggagctagccgag
gccgaggagtttgatgtgtataagaaatatgcacatgatgtcacctcgcaggcgtcgcgc
gatgcactcagcaatctgctggccaagcccgatgcattatcattaatgtcagcgggacat
ggctttcgagaggcggtcaagtattatttgcccaagctgcttctggtgcccatttgccat
gcgtttgtctattttgattacatcaagcaccttatggatctcagtacatcacaggatgac
atcgagagttttgcccaggtgcagggattgcttcatccgctgcactgtgatctcgagaag
gtaatggccaatctgtccaaggagcgacttgtgccggtcagcggacgcgttcgacgccaa
atggccattgagcgcacacgcgaactccagctcaaagtggagcactgggatgacaaggat
gtgggcctgaactgtaacgagttcatacgcgaggatgcactcagcaaactcggctcaggc
aagcgcatctggagcgagcgtaaagtattcctttttgatggcctcatggtgctatgcaaa
gcgaataccaaaaagcaaactccatcggcaggcgcaactgcctatgattacaggctgaag
gagaagttttttatgcgtcgcgtcgagattaacgatcgggcggatacggaggagttgaag
catagctttgagctaatcacccgcatgcatccggccattgtgttgtcggctaagaatgcc
caacacaagaacgattggatggcggatttgataatggtgaataccaaatcgatgttagat
cgcatactggacagcatactgcaggatattgagcgcaaacatccgttacgcatgcccagc
ccggagatatacaagtttgctgtgcccgacagcgccgagaatattgtgctcgaggagcga
gacagcggcgtggtgcccatgatcaagggggccacactgtgtaaactgattgagcgcctc
acctatcacatttatgcggatccaacatttgtgcgcacctttctcaccacatatcggtat
ttttgctcaccgcagcagctgctcacgttgctgatagagcgctttgaaatacccgagccg
agcctggtttatcaggaacagcagacaaataatattggcggcggtggcggtaactctgat
ctcgataaggatgcagcgacagctactgcgtcaacggcggacagtgataaaatgcttaag
aactcgcagcgcgaggattggaaacgttatcgcaaggagtttgtccagccagtgcagttt
cgtgtgctaaatgtgctgcggcactgggtggatcatcatttttatgattttgagaaggat
ccgacactgctggacagactgttacactttctcaacgatgtcaacagcaaatccatgcgt
aaatgggtcgactctgtgcgcaagattgtcgatcgtaagaataaacaaagcaataagaag
atcgtctatgcctatgggcatgatccgccgcccattgaataccatctgaatgtgccggac
gatgaaattacgctgcttactctacatccgctggaggtggcgcgacagttgacactgctg
gaatttgagatgtacaagaatgtgaagccatcagagctggtcgggtcaccgtggactaag
aaggacaaggagctaaagagtcccaatctgctcaagatcatgaagcataccacaaatgta
acgcgctggatcgaaaggtccatcatggaggcggagaactacgatgaacgtttggccatt
atgcagcgcgccattgaggtgatgatggtcatgctcgagttaaacaatttcaatggcata
ctctcaattgtggctgccatgggcacagctgctgtttttcgtttgcgcgccacattcaat
gggttgccagaacggcatcgtaagttcctggacgagtgccgtgaattgagcgaggatcat
ttgaagaaataccaggaacgtttgcgttccattaatccgccctgcgtgccattctttggt
cgttatttgacaaatattttgcatctggaggaaggaaatccggatctgttgaccaacacg
gagcttatcaatttctcgaaacggcgaaaggtgtcggaaatcatcggcgagatacaacag
taccaaaatcagccgtattgtctcaacgaagagcccaccatacgacactttttcgagcag
ctggatcccttcaatggactatccgacaaggaaatgtccgactatctgtacaatgagagt
ctacgcattgagccgcgcgcctgcaaaactgttcccaaattcccccgcaaatggccgaac
attccgcttaaatcgccgggcattaagcctcgtcgtcagaaccaaaacaacaacagcaac
aagttgtccagcaatgcgccagccagtgtggagccacccgcagcggcggccgcggcgtcg
tcaacagcgagtacgacggcaaccagtatcggcgatcagagtccgcagcataatccccat
gcatattccgtatttgcgccggtcatcataccggagcgcaatggcggcagcagctggagc
agccatacgatgcaccgcaccacagacaatggtgaagtggcgccggcgccgcatctgcca
cgcaagccggcagcgcatgtctggacacacaacagcaatgctccaacggatgggtttagt
ccagcggagcaacagttgccaccgccagcaacatcggctgcggctaccagcagctggaac
atgtcggattgttatgtcatttcggatgcgaatacagctgaagtgttgccgccatcgcca
ctgccgaaactgatgattagtccaaggcacgaaactgcgccaccaccgccgccgcccgcc
agcaatcgctcaccattccatggacgcatccaacagatgcaatatagtccgacgcacagc
attgccagcacggtgacgcttattagcggcggtttcggtgatgtgagtccacagctgggc
ggcttctactataacagtgaacagggacatggccagacaggcgcagtgcccatatcgccg
catgtgaatgtgcccacagcaaccacattagagtatcgagcggtgccgccaccattgcca
ccgcgacgcaaagagcgtacggaaagctgtgcggatatggcacaaaagcgccaagcgccc
gatgcacccacactacctccgcgcgatggcgagctgagcccaccgcccataccgcccaga
ctcaatcattccacggcaacgggctttacgcgtcagccaaaggagtttgtgggcaagagc
agcagcctgttgttgcccaacacgagcagtattatgatacgccgtaattcggcaaagcaa
ccatcgctgggtgtgagcacgtcaactgcgacggccaacaatagtgctgccgcaactcca
atgatggctcattccgtggccatggcgggcagcgaagagccacagcagcaacaacagttg
caacagccgccgcagtcgatttcgccagcgttaagctcttcgacaaccacatcacccatg
acacctatgacgcccatgtcaccgtacattcccagcacagtagacggcagcacgacgagc
agtttcccacagcaacagcaacagcagcatcagcatcaaacacgcctaaggccacagact
gcgcaaacgcaacaaccagtggcttatgcacaacagcatcaacatcatcaccagcatcag
caccaacagcatcattcccattcacatccgcatacccatacgcatgcgcattcacagcat
caacatccatcacagcacccgaacagacgctcgtccccaaaggaattctttccgattgcc
acgagccatgagggcacacccaaacttccaccaaaacctagtctaagcgcaaacttctac
aacaatccagataaaggtacgatgtttctttacccaagtacaaaccaagaataa

DBGET integrated database retrieval system