KEGG   Drosophila virilis: Dvir_GJ18180Help
Entry
Dvir_GJ18180      CDS       T01066                                 

Definition
GJ18180 gene product from transcript GJ18180-RA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dvi  Drosophila virilis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dvi00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dvi00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 869 aa AA seqDB search
MKYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPIGGIGGGSIGRGYAGEFCRFQMRPGI
YEYNVVHANQFIVTIKDHKGCTIFQSLLSRCSTKSFKAKTNNNDAEADEADAQKTKCQLP
NCSSRPRQPLSAWHSNIEDSRCSYTGLYPRAWTEYDLSHYGVRLICRQISPVIPHDYKES
SLPCAVFVWSVQNVCDQERKVSITFTFKNGTGNKKQDADGNAESQLISEGNAKGVAIRQN
IADMPCSYNLACRVLPEISITRCPQFDPAGNGEQLWAQLKEHGQLSEQPTAETLRSKDIG
VAVCAQLALKPQAYHELEFVLAWDMPKIQFPRKLQTHTRYYTKYFDDSGESGPRICEYAL
KHYASWERLIDAWQRPILNDDGLPDWYKCAIFNQLYFISDGGTIWLKCDSSLGQSLAFDD
PRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQVSLQYDFKDAIAAELNDTRK
MLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDWKDLNTKFVLQVYRDYYVL
NELAQAQADNASKFSSIEFIDKESLYELYTQDNKRKNSAEEKQQNRKSASMYINETNGKV
YLMDAMGYLKAMYGACKAIMERTIEYDKDNDGLIENTKMPDQTYDSWVMDGPSAYCAGLW
LAALQTMSVMATLLDQPNDCLRYQDILEKGKHSLEEKLWNGSYYRFDLSHNHRDTIMADQ
LCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGNIGAANGFIANASEPSKPGH
VDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYKTISQRIGMNYETPEALYGE
KRYRSIGYMRPLSIWSMQVAWERRRALRD
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgccgcctactactggaaggtgtcgcgcgaaggtcgtcgggtgtacatggac
tactactatatggagaacggtaaacagatctatggcgtgcccatcggtggcattggtggc
ggcagcattggacgcggctatgccggtgaattctgtcgctttcaaatgcgccccggcatc
tatgagtacaatgtggtgcatgccaatcaatttattgttaccatcaaggatcacaagggt
tgcaccatctttcagagtttgctctccaggtgcagcaccaaatcatttaaggcaaagacc
aacaacaacgatgctgaggccgatgaagccgatgcacaaaaaactaaatgtcaactgccc
aattgcagcagccgacccaggcagccactgagtgcctggcactcgaatatcgaagactcc
cgctgcagttatacgggtctatatccgcgcgcctggaccgaatacgatctgtcgcactat
ggtgtgcgattgatctgtcgccagatctcgcccgtgataccgcacgactacaaggaatcc
agtttgccctgcgccgtgttcgtgtggtctgtccaaaatgtgtgcgatcaggagcgcaag
gtgtccattacgtttacgtttaagaatggcaccggcaacaaaaaacaggatgcggatggc
aatgccgagtcgcagctaatcagcgagggcaatgccaagggcgtggccattaggcagaat
attgcagatatgccctgcagctataatctggcctgtcgcgtgctacccgaaataagcata
acacgttgtccccaattcgatccggctggcaatggcgaacagctgtgggcacagctcaag
gagcatggccagctcagcgagcagcccaccgcggagaccctgagatccaaggacataggt
gtagctgtctgcgcacagctggcactcaagccgcaggcctaccatgagctggagtttgtg
ctggcctgggacatgcccaagatacaatttccgcgcaagctgcaaacgcacacacgctac
tataccaaatactttgatgacagcggcgagtccggccccaggatatgcgagtatgcactg
aagcattatgccagctgggagcggctcattgatgcctggcagcgacccatactgaatgat
gacggcctgcccgattggtataaatgcgccatattcaatcagctttatttcatctcggat
ggcggcacaatctggctgaaatgcgactcatcgctgggccagtcgctggcttttgatgat
ccacgcttggcatatggtcgctttggttatctggagggtcatgagtatcgcatgtacaat
acgtatgatgtgcatttctatgcctcgcccgcgttggcgcatctgtggcccaatttgcag
gtcagcttgcaatacgatttcaaagatgcgattgccgctgagctgaatgatacacgtaaa
atgctctacgatggaaaagtaatgccgcgcaaggttaaaaattgcgtgccacacgatctg
ggtgatcccgatgaagaaccctttacactgatcaattgctataacatacacgatgtgaat
gactggaaggatctcaatacgaagtttgtgctgcaagtctacagagattactatgtgctc
aatgaactggcccaagcgcaagcggacaatgccagcaaattcagttcgattgagtttatt
gacaaggagagcctctacgagctgtacacgcaggacaacaagcgcaagaactcggcggag
gagaaacagcagaatcgtaaatctgcctctatgtacatcaatgagaccaatggcaaggtc
tatctcatggatgccatgggctatttgaaggccatgtatggcgcctgtaaggccattatg
gaacgcaccattgagtatgacaaggataatgatggcctcattgagaacaccaaaatgccg
gatcagacctatgactcgtgggtcatggatggaccgagcgcttattgtgctggcctctgg
ctggccgcgctgcaaaccatgtccgtcatggccacacttttggatcagcccaacgactgt
ttgcgctatcaggatatcttggagaagggcaagcactcgctggaggagaagctctggaat
ggcagctattatcgctttgatttgtcacacaatcatcgcgatacgattatggccgatcag
ctttgcggtcattggtatttaaagtcctgcggctttgactatgagatctatcccaaggag
aatgtccgcacagctctcaaacgcatctacgacaacaatgtgatgggctttcatgagggc
aacattggcgccgccaatggcttcatagcgaatgccagtgagccctcaaagccaggccat
gtggacaacagcaacatacaggccgaggaggtctggccgggcgttgtatatgctctagcg
gccaccatgatacaggagggcatgtttgaggaggccttccaaaccgctggcggcatgtac
aagaccatatcgcagcgcattggcatgaactatgagacgccggaagcactatatggcgag
aaacgttatcgctcgattggctatatgcgacccctgagcatttggtcgatgcaagtggcc
tgggagcgacgccgggcgttgcgcgactaa

DBGET integrated database retrieval system