KEGG   Drosophila virilis: Dvir_GJ18180Help
Entry
Dvir_GJ18180      CDS       T01066                                 

Definition
GJ18180 gene product from transcript GJ18180-RA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dvi  Drosophila virilis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dvir_GJ18180
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dvir_GJ18180
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dvir_GJ18180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 869 aa AA seqDB search
MKYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPIGGIGGGSIGRGYAGEFCRFQMRPGI
YEYNVVHANQFIVTIKDHKGCTIFQSLLSRCSTKSFKAKTNNNDAEADEADAQKTKCQLP
NCSSRPRQPLSAWHSNIEDSRCSYTGLYPRAWTEYDLSHYGVRLICRQISPVIPHDYKES
SLPCAVFVWSVQNVCDQERKVSITFTFKNGTGNKKQDADGNAESQLISEGNAKGVAIRQN
IADMPCSYNLACRVLPEISITRCPQFDPAGNGEQLWAQLKEHGQLSEQPTAETLRSKDIG
VAVCAQLALKPQAYHELEFVLAWDMPKIQFPRKLQTHTRYYTKYFDDSGESGPRICEYAL
KHYASWERLIDAWQRPILNDDGLPDWYKCAIFNQLYFISDGGTIWLKCDSSLGQSLAFDD
PRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQVSLQYDFKDAIAAELNDTRK
MLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDWKDLNTKFVLQVYRDYYVL
NELAQAQADNASKFSSIEFIDKESLYELYTQDNKRKNSAEEKQQNRKSASMYINETNGKV
YLMDAMGYLKAMYGACKAIMERTIEYDKDNDGLIENTKMPDQTYDSWVMDGPSAYCAGLW
LAALQTMSVMATLLDQPNDCLRYQDILEKGKHSLEEKLWNGSYYRFDLSHNHRDTIMADQ
LCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGNIGAANGFIANASEPSKPGH
VDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYKTISQRIGMNYETPEALYGE
KRYRSIGYMRPLSIWSMQVAWERRRALRD
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgccgcctactactggaaggtgtcgcgcgaaggtcgtcgggtgtacatggac
tactactatatggagaacggtaaacagatctatggcgtgcccatcggtggcattggtggc
ggcagcattggacgcggctatgccggtgaattctgtcgctttcaaatgcgccccggcatc
tatgagtacaatgtggtgcatgccaatcaatttattgttaccatcaaggatcacaagggt
tgcaccatctttcagagtttgctctccaggtgcagcaccaaatcatttaaggcaaagacc
aacaacaacgatgctgaggccgatgaagccgatgcacaaaaaactaaatgtcaactgccc
aattgcagcagccgacccaggcagccactgagtgcctggcactcgaatatcgaagactcc
cgctgcagttatacgggtctatatccgcgcgcctggaccgaatacgatctgtcgcactat
ggtgtgcgattgatctgtcgccagatctcgcccgtgataccgcacgactacaaggaatcc
agtttgccctgcgccgtgttcgtgtggtctgtccaaaatgtgtgcgatcaggagcgcaag
gtgtccattacgtttacgtttaagaatggcaccggcaacaaaaaacaggatgcggatggc
aatgccgagtcgcagctaatcagcgagggcaatgccaagggcgtggccattaggcagaat
attgcagatatgccctgcagctataatctggcctgtcgcgtgctacccgaaataagcata
acacgttgtccccaattcgatccggctggcaatggcgaacagctgtgggcacagctcaag
gagcatggccagctcagcgagcagcccaccgcggagaccctgagatccaaggacataggt
gtagctgtctgcgcacagctggcactcaagccgcaggcctaccatgagctggagtttgtg
ctggcctgggacatgcccaagatacaatttccgcgcaagctgcaaacgcacacacgctac
tataccaaatactttgatgacagcggcgagtccggccccaggatatgcgagtatgcactg
aagcattatgccagctgggagcggctcattgatgcctggcagcgacccatactgaatgat
gacggcctgcccgattggtataaatgcgccatattcaatcagctttatttcatctcggat
ggcggcacaatctggctgaaatgcgactcatcgctgggccagtcgctggcttttgatgat
ccacgcttggcatatggtcgctttggttatctggagggtcatgagtatcgcatgtacaat
acgtatgatgtgcatttctatgcctcgcccgcgttggcgcatctgtggcccaatttgcag
gtcagcttgcaatacgatttcaaagatgcgattgccgctgagctgaatgatacacgtaaa
atgctctacgatggaaaagtaatgccgcgcaaggttaaaaattgcgtgccacacgatctg
ggtgatcccgatgaagaaccctttacactgatcaattgctataacatacacgatgtgaat
gactggaaggatctcaatacgaagtttgtgctgcaagtctacagagattactatgtgctc
aatgaactggcccaagcgcaagcggacaatgccagcaaattcagttcgattgagtttatt
gacaaggagagcctctacgagctgtacacgcaggacaacaagcgcaagaactcggcggag
gagaaacagcagaatcgtaaatctgcctctatgtacatcaatgagaccaatggcaaggtc
tatctcatggatgccatgggctatttgaaggccatgtatggcgcctgtaaggccattatg
gaacgcaccattgagtatgacaaggataatgatggcctcattgagaacaccaaaatgccg
gatcagacctatgactcgtgggtcatggatggaccgagcgcttattgtgctggcctctgg
ctggccgcgctgcaaaccatgtccgtcatggccacacttttggatcagcccaacgactgt
ttgcgctatcaggatatcttggagaagggcaagcactcgctggaggagaagctctggaat
ggcagctattatcgctttgatttgtcacacaatcatcgcgatacgattatggccgatcag
ctttgcggtcattggtatttaaagtcctgcggctttgactatgagatctatcccaaggag
aatgtccgcacagctctcaaacgcatctacgacaacaatgtgatgggctttcatgagggc
aacattggcgccgccaatggcttcatagcgaatgccagtgagccctcaaagccaggccat
gtggacaacagcaacatacaggccgaggaggtctggccgggcgttgtatatgctctagcg
gccaccatgatacaggagggcatgtttgaggaggccttccaaaccgctggcggcatgtac
aagaccatatcgcagcgcattggcatgaactatgagacgccggaagcactatatggcgag
aaacgttatcgctcgattggctatatgcgacccctgagcatttggtcgatgcaagtggcc
tgggagcgacgccgggcgttgcgcgactaa

DBGET integrated database retrieval system