KEGG   Drosophila virilis: Dvir_GJ18433Help
Entry
Dvir_GJ18433      CDS       T01066                                 

Definition
GJ18433 gene product from transcript GJ18433-RA
Orthology
K15293  
protein unc-13
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3008 aa AA seqDB search
MKHNGCGSSTKYSDDVPIEGTYTRRGNRIGVCLPTAPASSTTIVMDNSKYRMLPHAAAYQ
NVHAENNLNGHSGYASNAGLIDERIGSFISLPAAPMRTLPEPQQRPSSSHRLFEDNNLKA
DAFGNQNVRDSVSATLGSARGPTSYDVFYQMARPYTSMLPLDYTDCSEFGGNSDNLSAFS
DTPPVSNAQHKLQQQRKISLMMAMTTASVIASGETRVPVQHSNRRIDNYSGSATTVVPCC
DENISICASSSSSVAFTNATTIALARWSTTDAQTTTTMTTTTTTTRKLPKRLPSPAIQYK
SSHTTGTSVPEVISEITFPSQAQFEKNHRAKQLPKLPLPKAQANLNSVYIGSDISINRTA
SMVLSSGISVSSSPERLPAIPDSERMTTHMAPSSPMMSTTAVAFVDGANNFFRLEESQAF
TKMCSRTQLQSNQSEVPRSVDSFRSWPPTSIATESLSLYQSELSSDKAKLNFTVPAKLTQ
KTSTELAVEQESSSAVPKSNHYHSAFTATETTVTIPALCESKTSSFDISDYLKPYTFDSL
KFSTENDHTMIPTVARTTFDTYVSCRDSLDSFKLTSLESQMPNSITSWTTSPITIESSLL
SGDVAAVLTAPKEEMVTTPPSESSSTLSYLPNKPILPIPTTMEGKKSDQFAATSDSHDAV
TTLSHLSNVFTTNVMASSSSTIDIINTSPASVSTPASIIAHLPTLSYIDYMKKFELPELP
PILDICSDETTAVFPETSSADNVTATTDAGFRKFNTSLFAETETFKSTATMPSHTHPTES
SMHCVHECNEFGVQSYQPNQYQSEIPTCSPNLAPINTVSTHSVMNKYQDIMSTEAKLDSG
ISLQLEPQISETVPDYLSSHIDQTLVSTVSAFDDSFYDSFNVDLTALTATIAHIESETCL
TPALKPNSNDTLNYLPCDPSSNAYMDVRETGSSNELNESFGFRQGGYYKPSQKQQQQPCV
QDEAPHTPQKSKVVASAATSVLGGLSKGIKGGLDGVLSGVSSTMEATKQYPANNNSKKSF
GFGLASKLVPNVGGLLSSSNKQDQQQEAAPTISTVSVIISTADSAQHMLNCQSTSKGYEY
VNENVIDTNTNTDVSVSHTPTTGYLEELRSVQNNSSVLETKSNLAYDYLGNYEPDSSAIE
VIGLNDDYRYGEYSAPYQTTDEGHIDSLYSYTGPYKSIVGSEMELGSTMAVDTIPFTQYQ
SSMSSSNLPAAEQTSMLETGIISVTETGTSKSQSVAPKVGIKKDRSSTVGSTGGMLGSIF
GKAAAAVQSATQAVNQGASSVASAVAQKASTPSAVVTTVGQTKPRDVPAISSSNQSATPV
SSVSFVSNIEQEPTQAANTISTSNASGAIGFHRVIDNDYNELVTNPDSVSSQYSTAGDDY
ENSNTHMLGDDMSVHMNINDNKAYSIYYSGGNQIQQIDTKDTPAVHSSMLGKVIAGQKLL
PAVPSAVSTGKKLPTINGKSGLLIKQQPTEIFDDESDDDLTEYFMGHPDKVDHEPNYCID
SEQDDYYMDPQQTTPSSRGANDYYEQVSAGYDYREDFFNEEDEYKYLEQQTQQQQHQYQH
QHQSQKLLLSHKQSSLDYVDDEQNDDFLNETYQSDEDCGNYLDESSSGSVGIAEGRKQQA
EDNGFITGTTSIATMGMNTTPAIANTAERSSLRTSKAAGICLQLGEGHQQIKKQDSIIIE
EEESSPIDLNNDCRVAAHMSPEGDADDDDQLADLLPTGGQPQKKKILMRGETEEVVSGHM
QMIRKPEITAKQRWHWAYNKIIMQLNNGTGTGDVSLRSNGHPGDNPFYSNIDSMPDIRPR
RKSIPLVSELVLKTMAATKRNAGLTSAVPRATLNDEELKMHVYKKALQALIYPISSTTPH
NFVLWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKH
GAEDKANSIITAMKDRMKQREREKPEIFELIRMTFGVDPDTHIDSLEQAEHATVEGTSKW
SCKLTITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNS
SDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAV
SGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENSGMVKLPIQKGDDAWKLYFD
EIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASS
AVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSQEKLMDLKSTVDLLTS
ITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNETKRDTD
DHGPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSAATMWGLFAVDMK
YALEEHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPEYPAWFEPFVMQWLNEN
DDVSLEYLHGAFNRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKR
YMRRFAKTIVKVLIAYADIVKMEFPEHLRDERIACILMNNIQQLRVQLEKMFESMGGDKL
EEDAANILKELQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGGGTLTAGNQ
AVQRNAVAVEADDVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLP
PMTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNL
SPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSSELQSLRYALSLYTQMTDTLIKTFIS
SQVHEVDPENAEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVEI
NLIGPHLQDKKRKFATKSKSNNWSPKYNESFSFAIGNEEQLDFFELHICVKDYCFARDDR
LVGVAVIPLKDISEKGSVACWLPLQRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEI
RQEPTMGT
NT seq 9027 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacaatgggtgtggctcgtcaacgaaatattcagatgatgtgccaattgaaggt
acgtacaccagaagaggcaatcgcattggtgtctgcctgccaaccgcacccgcgtcgtcg
acgacaatagtaatggataattcaaaatatcggatgttaccgcacgcggctgcttaccaa
aatgttcacgctgaaaacaatctgaatggacattccggctatgcatcgaatgctggttta
atagacgagagaataggtagttttattagtttgccagcggcaccaatgcggacgttaccc
gagcctcagcaacgacccagctcctcacatcgattatttgaagataacaacttaaaggca
gatgccttcggaaatcaaaacgtgcgtgatagcgtatcggctacactagggtcagccaga
gggcccactagttatgacgtattctaccaaatggctcgaccctacacatctatgctgccg
ctcgactacaccgactgctccgagttcggtggtaattctgataacttgtcagcgttcagt
gacacgccgccagtgagcaatgcgcagcacaagttgcaacagcagcgaaaaatctcactt
atgatggcaatgacaacagcttctgtgatagcatctggggagacaagagtaccggttcag
cactccaataggcgcattgataattattcaggctcggccaccactgtagtgccatgttgc
gatgaaaatatcagcatttgtgcatcttcctcctcctcagttgcctttaccaacgctact
acgatagctttagcacgctggtcaacaacagacgctcagacaactactacgatgacgacg
acgacgactacaactagaaaattgccaaaacgtctgccgtcaccagctatacagtataaa
tcgtcgcatacgactggcacatcagttcccgaagtgatttcagaaattacattcccatca
caagcgcagtttgagaaaaatcatcgcgcaaagcagttgccaaagttgcccttaccaaaa
gcacaagctaatttgaactcagtttatattggttcagacatcagtatcaaccggacagca
tcgatggttttatcatcaggaatttctgttagctcatcgccagagagattgcctgcaata
ccagattccgaacggatgactacccacatggccccaagttctcctatgatgtcaacgaca
gccgtggcctttgttgatggtgccaataattttttccgcttggaggagagtcaagcattt
acaaaaatgtgtagtagaactcagctccagagcaatcagagcgaagtgcctaggtctgtc
gactcatttagatcttggccaccaacttcgatagccaccgaatcgctttcattatatcaa
agtgagctttcaagcgacaaagccaagctaaatttcacagtgcccgccaaactcactcaa
aaaacatcaactgaattggcggtagagcaagaatcatcttcagcggtcccaaaatcaaac
cattaccattcggctttcacagcaacagaaacaacagtaacaattcctgctttgtgcgaa
tctaagacatcatcatttgacatatctgattacttaaaaccttatacatttgattcactt
aaattttcgactgaaaatgatcacaccatgatcccaactgtcgcgaggactactttcgac
acatacgtaagttgtagggactcgttggactcatttaaactgacatcactggaatcccaa
atgccaaattcgattacctcatggacgactagccccattaccattgaatcatcactgtta
agcggtgatgttgccgccgttttaacggcaccaaaagaggaaatggtcacaacgccacca
agtgagtcttcgtccactttgtcgtatctaccaaataaaccgatcttaccgatcccgaca
actatggagggtaaaaagtctgaccaatttgcagcgacgagtgattctcacgatgcagtc
acaactttaagccacttgagtaacgtgttcacaacaaacgttatggcgtctagttcttcg
acaatagacatcattaacactagtccagcttcagtttctacgccagcgtcaattattgct
catttacctacgctctcgtacattgattatatgaaaaagtttgaacttcctgaactgccg
ccgattctggatatttgtagtgacgagacaacagcagtttttccagaaacaagttctgca
gataacgttactgctactacagatgcagggtttcgaaaattcaatactagtttattcgcg
gagacagaaacatttaaaagtacagcaacaatgccttcccatactcatcccacagaatca
agcatgcattgcgtgcacgaatgtaatgaatttggagtacaaagctatcagcctaatcaa
tatcaaagcgaaattcctacctgttcgccaaacctagccccgataaatactgtttccact
cattctgttatgaacaaataccaagacataatgtcaaccgaagcaaaactcgacagtggt
atctccttgcaacttgagccacaaatatcagaaactgtgccagattacttatcaagccac
attgaccagacattagtgagcacagtttcagctttcgatgacagcttttacgatagcttt
aatgttgatttgacagcgttgacagcaacaattgcacatattgaaagcgagacgtgctta
actcctgctctgaagccaaacagcaatgatacgctgaattatctgccctgtgatccatcc
agtaacgcatacatggatgtaagggaaacaggtagttcaaatgaactgaacgagtcgttt
ggttttagacaagggggatattacaagccatctcaaaaacagcaacaacagccgtgtgtg
caagacgaagctccacatacacctcagaaatctaaagtcgttgcgtcggcagctaccagc
gtcctgggaggtctatctaagggaatcaagggcggattggatggtgtgctcagcggtgtt
agctccacgatggaagcaactaaacagtatccagccaacaataacagtaagaaaagtttt
ggctttggattagcctcaaaattggtaccgaatgtgggaggattgctttccagctcaaac
aagcaagaccaacagcaggaagcagcaccaacaatttccaccgtctctgttataatttca
acagcggacagtgcccaacatatgctcaactgtcaaagcacatcaaagggatatgaatat
gtaaatgaaaacgttattgatacgaataccaacacggacgtaagcgtcagtcataccccg
actactgggtatctggaagagttacggtccgttcaaaacaatagttccgtgctagaaacc
aagtcaaatctagcttatgactacctcggaaattatgaacctgatagctccgcaatagag
gtcataggattaaatgacgactataggtacggtgaatattctgcaccgtaccaaacgaca
gatgagggtcatattgacagtttatacagttacacaggtccttataaatcaattgttgga
tctgaaatggagctaggatcgaccatggcagttgatacaattcctttcactcaatatcaa
tcttcaatgtcatcgagtaacttacccgctgcagaacagacctctatgcttgaaacagga
atcatatctgtaaccgaaaccggaacaagtaagtcccagtcagtagctccaaaggtgggt
ataaaaaaagacagatctagcactgtcggcagcactggtggtatgttaggctcaattttt
ggtaaggctgcagcagcggtacagtctgctacgcaggcggtcaatcagggtgcctcctct
gttgcctcagctgtggctcaaaaagcatcgacaccatctgcagttgtcacaacagttggg
caaaccaagccccgagacgtgccagccatatcgtcttctaaccaaagtgcaaccccagtc
tcgagcgtatcgtttgtttctaacattgagcaagaaccaacgcaggcagccaatacaata
tcgacatcgaacgcgtctggagccattggatttcacagagttatagacaatgattataac
gagctagtcactaacccggactcggtgtcaagccaatattcaacagctggcgatgattac
gagaatagcaacactcacatgcttggtgacgacatgtcagtgcatatgaatatcaatgat
aataaagcgtactctatatactattcgggtggtaatcagatccagcaaattgataccaaa
gacacgccagccgtacactcatcgatgctgggtaaagtgatagctggacagaagctacta
ccggcggtgccgtcagcagtatccaccggcaaaaaactgcccaccattaatggtaaatcg
gggctgctaattaagcagcaaccaactgagatctttgatgatgaatcagatgatgatctc
actgaatattttatgggacaccccgataaggttgaccatgaaccgaattattgcatcgat
agtgagcaggatgattactacatggatcctcagcagacgacaccgtcaagtcgaggtgca
aatgattattatgaacaagttagtgcaggttatgactatcgagaggatttctttaatgaa
gaggatgaatataaatatcttgagcagcagactcaacagcagcagcatcagtatcagcat
cagcaccaatcacaaaaattattgctcagtcataagcaatcatcattagactatgtggac
gatgaacaaaacgacgatttcttgaacgagacttatcaaagcgatgaggactgtggcaat
tatctagacgaaagctcgagtggtagcgttggtattgccgaaggccgtaaacaacaagcg
gaggataacggcttcattacgggtacgacctccattgccactatgggcatgaatacaact
ccagctatcgccaatactgctgagcgtagttcgcttcgcaccagcaaggctgcagggatt
tgcctgcagcttggagagggtcaccagcaaattaaaaaacaggacagcattattatagaa
gaagaagaatcaagtccgatagatttaaacaacgattgccgtgtcgcagcacacatgtcg
cctgaaggagacgctgatgatgatgatcaactggctgatctgttacccacaggaggccag
ccccaaaagaagaagattctgatgcgaggcgaaactgaagaagttgttagcggtcatatg
cagatgatacgaaagccggagattacggctaagcagcgatggcattgggcctacaacaaa
atcataatgcagctaaataatggcaccggaacaggtgatgttagtttgcgatccaatggc
catccgggtgataatccgttctacagtaatattgacagcatgcccgacattcgtccaagg
cgaaaatctattccccttgtctctgaactggtgctcaagacaatggcagccacgaaacgt
aatgccggactgacgtcggcagttccccgagcaacgcttaatgatgaagaattgaaaatg
catgtctacaaaaaggcgctgcaggcactcatctacccaatatcatcaaccaccccacat
aactttgtactgtggacggccacctccccaacttattgctatgagtgcgagggcttactt
tggggcattgcccgccagggagtacgatgcaccgagtgcggcgtaaagtgtcacgaaaag
tgcaaggatttactaaacgccgactgtctacaacgtgccgctgagaagagctccaagcat
ggtgccgaagataaagctaactccatcataaccgccatgaaggaccgcatgaagcaacgg
gaacgtgaaaaaccagaaatatttgaattgatcaggatgacattcggggtggatccagat
acacacatagattcattagaacaggctgagcacgcaactgttgagggaacatctaaatgg
tcatgcaaattaacaattacagtgatttgtgctcaaggcctgatagcgaaggataaaagc
ggtacgagtgatccatatgtgacggtgcaagttagcaaggtgaaaaaacgaacgcgcaca
atgccccaggagctaaaccctgtgtggaacgagaagtttcacttcgaatgccacaactct
tcagatcgtatcaaagttcgtgtgtgggatgaggacaacgatcttaagtcaaaactgcga
caaaagctgacgcgtgaatcagatgacttcctaggacaaaccataattgaagttcgaacg
ctgtccggagaaatggacgtgtggtacaatttggagaagcgtaccgataagtcggctgtg
tcaggtgctattcgactacacatttccgttgagataaagggcgaggagaaggtggcaccc
taccatgtacagtatacctgcctgcatgagaacctctttcattacttatgtgaagagaat
agcggaatggtcaagctacccatacaaaaaggcgatgacgcatggaagctgtactttgat
gaaattcctgaagaaatcgttgatgaattctcaatgcgttatggcatcgaaaatatatat
caagcaatgacacatttccattgtctctccgcaaagtatctatgcccaggagtgccggcc
gtgatgagcaccttattggcgaatattaatgcatattatgcacacacaactgcatcttca
gctgtttcggccagtgatcgctttgcagcgagtaactttgggaaggaaaaatttgtgaaa
ttgctagatcagctgcataactcgctgaggatcgatctctcaatgtatagaaataacttt
cccgcttctagtcaagaaaaacttatggatctcaagtcgacagttgacctcctgactagt
ataacatttttccgtatgaaggttcaagagctgtctagtccaccaagagctagtacagtt
gtcaaggattgcgtaaaagcttgtcttagatccacctatcaattcctttttgaaaattgt
tatgagctctacaacagggagtttcaggtggatccaaacgagacgaaacgtgataccgat
gaccatggcccaaaactagacagtgtagacttctggcacaagcttattgcattaattgtt
tctgttattgatgaagacaaaaacagttatggaacagtgctcaatcaattcccccaggaa
ctgaatattggacagctatcagctgctactatgtggggtctttttgccgtagacatgaag
tacgcgcttgaagagcacgagcagcatcgactttgcaagtcatctgcatatatgaatttg
cattttcgtgttaaatggctatacagtaattatgtgaaagaggtgccaccatataaagga
gctgtacctgagtacccagcctggtttgagcctttcgtaatgcaatggttgaatgagaac
gatgatgtgtcgttagaatatcttcatggtgcgtttaaccgtgacaaaaaggacgggttt
caaaaaagcagtgaacatgctttgttctcgaattctgtagtcgacgttttcacacaactg
acgcaatgtttcgatgttgttagcaagctcgagtgtccagatccagaaatttggaaacgt
tacatgaggcgttttgctaaaacaatcgtaaaagtgctaattgcctatgctgatattgtg
aaaatggagtttccagagcatctgagggacgaacgaattgcctgtattttaatgaacaac
atacagcagctaagagttcaattggagaaaatgtttgagtcaatgggaggtgataagcta
gaggaggacgcagccaatatccttaaagaacttcagcagaaccttaactcagctctggac
gatttagcttcacaatttgctataagcttggaaccacgtataactcagtcagtgcgagag
cttggtgacatgctgctttcgatcaagggaggtggcggaaccctaacagccggaaatcag
gcggtgcaaaggaatgcggtggccgttgaagccgacgatgtgctaagaccgttaatggac
ttacttgatggttccttaactttgtatgcccagtcctgtgaaaagacagtgctgaaacgt
ttgcttaaagaactttggaaaatagttatgcgaattttggaaaaaacaattgtcctgcct
ccaatgactgacaaaactatgatgttcaaacatcttactgataatgcaaagaatttggct
tcaaatgcaaaaatagaagacatgggccgcttgttcaagtcgcatatggctggaaaacag
gacgttaaaagtgctcttagcggtgttatggacatatcaaaagaagttgaaaaaaaccta
tcccccaaacaatgtgccgtgctagatgttgccttagatacaataaaacaatacttccat
gccggtggtaatggactgaaaaagacgtttctagaaaagtcatcggagttgcagagtttg
aggtatgcacttagcttgtatacacaaatgacagatacccttattaaaaccttcatttcg
agtcaagtgcacgaagttgaccctgaaaacgccgaagagagcgttggtgaaatctcagtg
caaatagacttattttcacatcctggcacgggagagcacaaagtcaacgttaaagtcgtg
gctgccaatgatctgaaatggcaaataccatctggaatgttcagaccatttgtggagatc
aatctaatcggaccgcaccttcaggataaaaagagaaaatttgcgactaaatcaaaatca
aataactggtctcccaagtacaacgaatcgtttagcttcgccattggtaatgaggagcaa
ctagatttctttgaactacacatctgcgttaaggactattgtttcgcccgagacgatcga
cttgtgggagttgcagttatacctttaaaggatatatctgaaaagggatcggtcgcatgt
tggttacctttacagcgccgcatcgaaatggacgagactggttggacaattctaagaata
ctatcgcagcgcaataacgacgaagtcgctaaggaatttgttaaactaaaatcagaaatt
cgtcaggaaccgacaatgggtacttaa

DBGET integrated database retrieval system