KEGG   Drosophila virilis: Dvir_GJ18433Help
Entry
Dvir_GJ18433      CDS       T01066                                 

Definition
(RefSeq) GJ18433 gene product from transcript GJ18433-RN
  KO
K15293  
protein unc-13 A/B/C
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 3109 aa AA seqDB search
MTHYARDECYHNNKNDALSTDSRPINNSTIYNYDEEHSGAYVYDEYGVSEEYSSDVNWPR
DEYVPEEQNVAGLPTAEYWDENIGAPIDYGGAGYGYGSTAPMKHNGCGSSTKYSDDVPIE
GTYTRRGNRIGVCLPTAPASSTTIVMDNSKYRMLPHAAAYQNVHAENNLNGHSGYASNAG
LIDERIGSFISLPAAPMRTLPEPQQRPSSSHRLFEDNNLKADAFGNQNVRDSVSATLGSA
RGPTSYDVFYQMARPYTSMLPLDYTDCSEFGGNSDNLSAFSDTPPVSNAQHKLQQQRKIS
LMMAMTTASVIASGETRVPVQHSNRRIDNYSGSATTVVPCCDENISICASSSSSVAFTNA
TTIALARWSTTDAQTTTTMTTTTTTTRKLPKRLPSPAIQYKSSHTTGTSVPEVISEITFP
SQAQFEKNHRAKQLPKLPLPKAQANLNSVYIGSDISINRTASMVLSSGISVSSSPERLPA
IPDSERMTTHMAPSSPMMSTTAVAFVDGANNFFRLEESQAFTKMCSRTQLQSNQSEVPRS
VDSFRSWPPTSIATESLSLYQSELSSDKAKLNFTVPAKLTQKTSTELAVEQESSSAVPKS
NHYHSAFTATETTVTIPALCESKTSSFDISDYLKPYTFDSLKFSTENDHTMIPTVARTTF
DTYVSCRDSLDSFKLTSLESQMPNSITSWTTSPITIESSLLSGDVAAVLTAPKEEMVTTP
PSESSSTLSYLPNKPILPIPTTMEGKKSDQFAATSDSHDAVTTLSHLSNVFTTNVMASSS
STIDIINTSPASVSTPASIIAHLPTLSYIDYMKKFELPELPPILDICSDETTAVFPETSS
ADNVTATTDAGFRKFNTSLFAETETFKSTATMPSHTHPTESSMHCVHECNEFGVQSYQPN
QYQSEIPTCSPNLAPINTVSTHSVMNKYQDIMSTEAKLDSGISLQLEPQISETVPDYLSS
HIDQTLVSTVSAFDDSFYDSFNVDLTALTATIAHIESETCLTPALKPNSNDTLNYLPCDP
SSNAYMDVRETGSSNELNESFGFRQGGYYKPSQKQQQQPCVQDEAPHTPQKSKVVASAAT
SVLGGLSKGIKGGLDGVLSGVSSTMEATKQYPANNNSKKSFGFGLASKLVPNVGGLLSSS
NKQDQQQEAAPTISTVSVIISTADSAQHMLNCQSTSKGYEYVNENVIDTNTNTDVSVSHT
PTTGYLEELRSVQNNSSVLETKSNLAYDYLGNYEPDSSAIEVIGLNDDYRYGEYSAPYQT
TDEGHIDSLYSYTGPYKSIVGSEMELGSTMAVDTIPFTQYQSSMSSSNLPAAEQTSMLET
GIISVTETGTSKSQSVAPKVGIKKDRSSTVGSTGGMLGSIFGKAAAAVQSATQAVNQGAS
SVASAVAQKASTPSAVVTTVGQTKPRDVPAISSSNQSATPVSSVSFVSNIEQEPTQAANT
ISTSNASGAIGFHRVIDNDYNELVTNPDSVSSQYSTAGDDYENSNTHMLGDDMSVHMNIN
DNKAYSIYYSGGNQIQQIDTKDTPAVHSSMLGKVIAGQKLLPAVPSAVSTGKKLPTINGK
SGLLIKQQPTEIFDDESDDDLTEYFMGHPDKVDHEPNYCIDSEQDDYYMDPQQTTPSSRG
ANDYYEQVSAGYDYREDFFNEEDEYKYLEQQTQQQQHQYQHQHQSQKLLLSHKQSSLDYV
DDEQNDDFLNETYQSDEDCGNYLDESSSGSVGIAEGRKQQAEDNGFITGTTSIATMGMNT
TPAIANTAERSSLRTSKAAGICLQLGEGHQQIKKQDSIIIEEEESSPIDLNNDCRVAAHM
SPEGDADDDDQLADLLPTGGQPQKKKILMRGETEEVVSGHMQMIRKPEITAKQRWHWAYN
KIIMQLNNGTGTGDVSLRSNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSELVLKTMAATK
RNAGLTSAVPRATLNDEELKMHVYKKALQALIYPISSTTPHNFVLWTATSPTYCYECEGL
LWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKDRMKQ
REREKPEIFELIRAVFSIEEKSHTGHMKAVKQSVLDGTSKWSAKIAITVICAQGLIAKDK
SGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKL
RQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVA
PYHVQYTCLHENLFHYLCEENSGMVKLPIQKGDDAWKLYFDEIPEEIVDEFSMRYGIENI
YQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAASNFGKEKFV
KLLDQLHNSLRIDLSMYRNNFPASSQEKLMDLKSTVDLLTSITFFRMKVQELSSPPRAST
VVKDCVKACLRSTYQFLFENCYELYNREFQVDPNETKRDTDDHGPKLDSVDFWHKLIALI
VSVIDEDKNSYGTVLNQFPQELNIGQLSAATMWGLFAVDMKYALEEHEQHRLCKSSAYMN
LHFRVKWLYSNYVKEVPPYKGAVPEYPAWFEPFVMQWLNENDDVSLEYLHGAFNRDKKDG
FQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADI
VKMEFPEHLRDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNSAL
DDLASQFAISLEPRITQSVRELGDMLLSIKGGGGTLTAGNQAVQRNAVAVEADDVLRPLM
DLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFKHLTDNAKNL
ASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQYF
HAGGNGLKKTFLEKSSELQSLRYALSLYTQMTDTLIKTFISSQVHEVDPENAEESVGEIS
VQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVEINLIGPHLQDKKRKFATKSK
SNNWSPKYNESFSFAIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVA
CWLPLQRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEPTMGT
NT seq 9330 nt NT seq  +upstreamnt  +downstreamnt
atgacgcattatgcccgggacgaatgctatcataataacaaaaacgatgccttatccact
gacagccgaccaattaataacagcactatctataattatgatgaagagcattcgggtgca
tatgtctatgatgagtatggcgtttcagaagagtactcttctgatgtgaattggcctcga
gatgagtatgtcccagaagagcagaatgtagctgggctaccaactgcggagtattgggac
gagaatatcggcgctccgattgattatggaggcgctggttatggatatggctcaactgca
ccaatgaaacacaatgggtgtggctcgtcaacgaaatattcagatgatgtgccaattgaa
ggtacgtacaccagaagaggcaatcgcattggtgtctgcctgccaaccgcacccgcgtcg
tcgacgacaatagtaatggataattcaaaatatcggatgttaccgcacgcggctgcttac
caaaatgttcacgctgaaaacaatctgaatggacattccggctatgcatcgaatgctggt
ttaatagacgagagaataggtagttttattagtttgccagcggcaccaatgcggacgtta
cccgagcctcagcaacgacccagctcctcacatcgattatttgaagataacaacttaaag
gcagatgccttcggaaatcaaaacgtgcgtgatagcgtatcggctacactagggtcagcc
agagggcccactagttatgacgtattctaccaaatggctcgaccctacacatctatgctg
ccgctcgactacaccgactgctccgagttcggtggtaattctgataacttgtcagcgttc
agtgacacgccgccagtgagcaatgcgcagcacaagttgcaacagcagcgaaaaatctca
cttatgatggcaatgacaacagcttctgtgatagcatctggggagacaagagtaccggtt
cagcactccaataggcgcattgataattattcaggctcggccaccactgtagtgccatgt
tgcgatgaaaatatcagcatttgtgcatcttcctcctcctcagttgcctttaccaacgct
actacgatagctttagcacgctggtcaacaacagacgctcagacaactactacgatgacg
acgacgacgactacaactagaaaattgccaaaacgtctgccgtcaccagctatacagtat
aaatcgtcgcatacgactggcacatcagttcccgaagtgatttcagaaattacattccca
tcacaagcgcagtttgagaaaaatcatcgcgcaaagcagttgccaaagttgcccttacca
aaagcacaagctaatttgaactcagtttatattggttcagacatcagtatcaaccggaca
gcatcgatggttttatcatcaggaatttctgttagctcatcgccagagagattgcctgca
ataccagattccgaacggatgactacccacatggccccaagttctcctatgatgtcaacg
acagccgtggcctttgttgatggtgccaataattttttccgcttggaggagagtcaagca
tttacaaaaatgtgtagtagaactcagctccagagcaatcagagcgaagtgcctaggtct
gtcgactcatttagatcttggccaccaacttcgatagccaccgaatcgctttcattatat
caaagtgagctttcaagcgacaaagccaagctaaatttcacagtgcccgccaaactcact
caaaaaacatcaactgaattggcggtagagcaagaatcatcttcagcggtcccaaaatca
aaccattaccattcggctttcacagcaacagaaacaacagtaacaattcctgctttgtgc
gaatctaagacatcatcatttgacatatctgattacttaaaaccttatacatttgattca
cttaaattttcgactgaaaatgatcacaccatgatcccaactgtcgcgaggactactttc
gacacatacgtaagttgtagggactcgttggactcatttaaactgacatcactggaatcc
caaatgccaaattcgattacctcatggacgactagccccattaccattgaatcatcactg
ttaagcggtgatgttgccgccgttttaacggcaccaaaagaggaaatggtcacaacgcca
ccaagtgagtcttcgtccactttgtcgtatctaccaaataaaccgatcttaccgatcccg
acaactatggagggtaaaaagtctgaccaatttgcagcgacgagtgattctcacgatgca
gtcacaactttaagccacttgagtaacgtgttcacaacaaacgttatggcgtctagttct
tcgacaatagacatcattaacactagtccagcttcagtttctacgccagcgtcaattatt
gctcatttacctacgctctcgtacattgattatatgaaaaagtttgaacttcctgaactg
ccgccgattctggatatttgtagtgacgagacaacagcagtttttccagaaacaagttct
gcagataacgttactgctactacagatgcagggtttcgaaaattcaatactagtttattc
gcggagacagaaacatttaaaagtacagcaacaatgccttcccatactcatcccacagaa
tcaagcatgcattgcgtgcacgaatgtaatgaatttggagtacaaagctatcagcctaat
caatatcaaagcgaaattcctacctgttcgccaaacctagccccgataaatactgtttcc
actcattctgttatgaacaaataccaagacataatgtcaaccgaagcaaaactcgacagt
ggtatctccttgcaacttgagccacaaatatcagaaactgtgccagattacttatcaagc
cacattgaccagacattagtgagcacagtttcagctttcgatgacagcttttacgatagc
tttaatgttgatttgacagcgttgacagcaacaattgcacatattgaaagcgagacgtgc
ttaactcctgctctgaagccaaacagcaatgatacgctgaattatctgccctgtgatcca
tccagtaacgcatacatggatgtaagggaaacaggtagttcaaatgaactgaacgagtcg
tttggttttagacaagggggatattacaagccatctcaaaaacagcaacaacagccgtgt
gtgcaagacgaagctccacatacacctcagaaatctaaagtcgttgcgtcggcagctacc
agcgtcctgggaggtctatctaagggaatcaagggcggattggatggtgtgctcagcggt
gttagctccacgatggaagcaactaaacagtatccagccaacaataacagtaagaaaagt
tttggctttggattagcctcaaaattggtaccgaatgtgggaggattgctttccagctca
aacaagcaagaccaacagcaggaagcagcaccaacaatttccaccgtctctgttataatt
tcaacagcggacagtgcccaacatatgctcaactgtcaaagcacatcaaagggatatgaa
tatgtaaatgaaaacgttattgatacgaataccaacacggacgtaagcgtcagtcatacc
ccgactactgggtatctggaagagttacggtccgttcaaaacaatagttccgtgctagaa
accaagtcaaatctagcttatgactacctcggaaattatgaacctgatagctccgcaata
gaggtcataggattaaatgacgactataggtacggtgaatattctgcaccgtaccaaacg
acagatgagggtcatattgacagtttatacagttacacaggtccttataaatcaattgtt
ggatctgaaatggagctaggatcgaccatggcagttgatacaattcctttcactcaatat
caatcttcaatgtcatcgagtaacttacccgctgcagaacagacctctatgcttgaaaca
ggaatcatatctgtaaccgaaaccggaacaagtaagtcccagtcagtagctccaaaggtg
ggtataaaaaaagacagatctagcactgtcggcagcactggtggtatgttaggctcaatt
tttggtaaggctgcagcagcggtacagtctgctacgcaggcggtcaatcagggtgcctcc
tctgttgcctcagctgtggctcaaaaagcatcgacaccatctgcagttgtcacaacagtt
gggcaaaccaagccccgagacgtgccagccatatcgtcttctaaccaaagtgcaacccca
gtctcgagcgtatcgtttgtttctaacattgagcaagaaccaacgcaggcagccaataca
atatcgacatcgaacgcgtctggagccattggatttcacagagttatagacaatgattat
aacgagctagtcactaacccggactcggtgtcaagccaatattcaacagctggcgatgat
tacgagaatagcaacactcacatgcttggtgacgacatgtcagtgcatatgaatatcaat
gataataaagcgtactctatatactattcgggtggtaatcagatccagcaaattgatacc
aaagacacgccagccgtacactcatcgatgctgggtaaagtgatagctggacagaagcta
ctaccggcggtgccgtcagcagtatccaccggcaaaaaactgcccaccattaatggtaaa
tcggggctgctaattaagcagcaaccaactgagatctttgatgatgaatcagatgatgat
ctcactgaatattttatgggacaccccgataaggttgaccatgaaccgaattattgcatc
gatagtgagcaggatgattactacatggatcctcagcagacgacaccgtcaagtcgaggt
gcaaatgattattatgaacaagttagtgcaggttatgactatcgagaggatttctttaat
gaagaggatgaatataaatatcttgagcagcagactcaacagcagcagcatcagtatcag
catcagcaccaatcacaaaaattattgctcagtcataagcaatcatcattagactatgtg
gacgatgaacaaaacgacgatttcttgaacgagacttatcaaagcgatgaggactgtggc
aattatctagacgaaagctcgagtggtagcgttggtattgccgaaggccgtaaacaacaa
gcggaggataacggcttcattacgggtacgacctccattgccactatgggcatgaataca
actccagctatcgccaatactgctgagcgtagttcgcttcgcaccagcaaggctgcaggg
atttgcctgcagcttggagagggtcaccagcaaattaaaaaacaggacagcattattata
gaagaagaagaatcaagtccgatagatttaaacaacgattgccgtgtcgcagcacacatg
tcgcctgaaggagacgctgatgatgatgatcaactggctgatctgttacccacaggaggc
cagccccaaaagaagaagattctgatgcgaggcgaaactgaagaagttgttagcggtcat
atgcagatgatacgaaagccggagattacggctaagcagcgatggcattgggcctacaac
aaaatcataatgcagctaaataatggcaccggaacaggtgatgttagtttgcgatccaat
ggccatccgggtgataatccgttctacagtaatattgacagcatgcccgacattcgtcca
aggcgaaaatctattccccttgtctctgaactggtgctcaagacaatggcagccacgaaa
cgtaatgccggactgacgtcggcagttccccgagcaacgcttaatgatgaagaattgaaa
atgcatgtctacaaaaaggcgctgcaggcactcatctacccaatatcatcaaccacccca
cataactttgtactgtggacggccacctccccaacttattgctatgagtgcgagggctta
ctttggggcattgcccgccagggagtacgatgcaccgagtgcggcgtaaagtgtcacgaa
aagtgcaaggatttactaaacgccgactgtctacaacgtgccgctgagaagagctccaag
catggtgccgaagataaagctaactccatcataaccgccatgaaggaccgcatgaagcaa
cgggaacgtgaaaaaccagaaatatttgaattgatcagagccgtattcagcattgaagag
aaaagccatactggtcatatgaaggctgtgaagcaaagcgtcctggatggaaccagtaaa
tggtcggcgaagatagcaatcacagtgatttgtgctcaaggcctgatagcgaaggataaa
agcggtacgagtgatccatatgtgacggtgcaagttagcaaggtgaaaaaacgaacgcgc
acaatgccccaggagctaaaccctgtgtggaacgagaagtttcacttcgaatgccacaac
tcttcagatcgtatcaaagttcgtgtgtgggatgaggacaacgatcttaagtcaaaactg
cgacaaaagctgacgcgtgaatcagatgacttcctaggacaaaccataattgaagttcga
acgctgtccggagaaatggacgtgtggtacaatttggagaagcgtaccgataagtcggct
gtgtcaggtgctattcgactacacatttccgttgagataaagggcgaggagaaggtggca
ccctaccatgtacagtatacctgcctgcatgagaacctctttcattacttatgtgaagag
aatagcggaatggtcaagctacccatacaaaaaggcgatgacgcatggaagctgtacttt
gatgaaattcctgaagaaatcgttgatgaattctcaatgcgttatggcatcgaaaatata
tatcaagcaatgacacatttccattgtctctccgcaaagtatctatgcccaggagtgccg
gccgtgatgagcaccttattggcgaatattaatgcatattatgcacacacaactgcatct
tcagctgtttcggccagtgatcgctttgcagcgagtaactttgggaaggaaaaatttgtg
aaattgctagatcagctgcataactcgctgaggatcgatctctcaatgtatagaaataac
tttcccgcttctagtcaagaaaaacttatggatctcaagtcgacagttgacctcctgact
agtataacatttttccgtatgaaggttcaagagctgtctagtccaccaagagctagtaca
gttgtcaaggattgcgtaaaagcttgtcttagatccacctatcaattcctttttgaaaat
tgttatgagctctacaacagggagtttcaggtggatccaaacgagacgaaacgtgatacc
gatgaccatggcccaaaactagacagtgtagacttctggcacaagcttattgcattaatt
gtttctgttattgatgaagacaaaaacagttatggaacagtgctcaatcaattcccccag
gaactgaatattggacagctatcagctgctactatgtggggtctttttgccgtagacatg
aagtacgcgcttgaagagcacgagcagcatcgactttgcaagtcatctgcatatatgaat
ttgcattttcgtgttaaatggctatacagtaattatgtgaaagaggtgccaccatataaa
ggagctgtacctgagtacccagcctggtttgagcctttcgtaatgcaatggttgaatgag
aacgatgatgtgtcgttagaatatcttcatggtgcgtttaaccgtgacaaaaaggacggg
tttcaaaaaagcagtgaacatgctttgttctcgaattctgtagtcgacgttttcacacaa
ctgacgcaatgtttcgatgttgttagcaagctcgagtgtccagatccagaaatttggaaa
cgttacatgaggcgttttgctaaaacaatcgtaaaagtgctaattgcctatgctgatatt
gtgaaaatggagtttccagagcatctgagggacgaacgaattgcctgtattttaatgaac
aacatacagcagctaagagttcaattggagaaaatgtttgagtcaatgggaggtgataag
ctagaggaggacgcagccaatatccttaaagaacttcagcagaaccttaactcagctctg
gacgatttagcttcacaatttgctataagcttggaaccacgtataactcagtcagtgcga
gagcttggtgacatgctgctttcgatcaagggaggtggcggaaccctaacagccggaaat
caggcggtgcaaaggaatgcggtggccgttgaagccgacgatgtgctaagaccgttaatg
gacttacttgatggttccttaactttgtatgcccagtcctgtgaaaagacagtgctgaaa
cgtttgcttaaagaactttggaaaatagttatgcgaattttggaaaaaacaattgtcctg
cctccaatgactgacaaaactatgatgttcaaacatcttactgataatgcaaagaatttg
gcttcaaatgcaaaaatagaagacatgggccgcttgttcaagtcgcatatggctggaaaa
caggacgttaaaagtgctcttagcggtgttatggacatatcaaaagaagttgaaaaaaac
ctatcccccaaacaatgtgccgtgctagatgttgccttagatacaataaaacaatacttc
catgccggtggtaatggactgaaaaagacgtttctagaaaagtcatcggagttgcagagt
ttgaggtatgcacttagcttgtatacacaaatgacagatacccttattaaaaccttcatt
tcgagtcaagtgcacgaagttgaccctgaaaacgccgaagagagcgttggtgaaatctca
gtgcaaatagacttattttcacatcctggcacgggagagcacaaagtcaacgttaaagtc
gtggctgccaatgatctgaaatggcaaataccatctggaatgttcagaccatttgtggag
atcaatctaatcggaccgcaccttcaggataaaaagagaaaatttgcgactaaatcaaaa
tcaaataactggtctcccaagtacaacgaatcgtttagcttcgccattggtaatgaggag
caactagatttctttgaactacacatctgcgttaaggactattgtttcgcccgagacgat
cgacttgtgggagttgcagttatacctttaaaggatatatctgaaaagggatcggtcgca
tgttggttacctttacagcgccgcatcgaaatggacgagactggttggacaattctaaga
atactatcgcagcgcaataacgacgaagtcgctaaggaatttgttaaactaaaatcagaa
attcgtcaggaaccgacaatgggtacttaa

DBGET integrated database retrieval system