KEGG   Drosophila virilis: Dvir_GJ18513Help
Entry
Dvir_GJ18513      CDS       T01066                                 

Definition
GJ18513 gene product from transcript GJ18513-RA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dvir_GJ18513
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dvir_GJ18513
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ18513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1151 aa AA seqDB search
MDIETDQSIEAMDTQDTQEVEIITSDLQQQQQQQQQQQQQQQQQQQQQQQQTNSPPQLPK
FKNLIHPQLQQQQQQQQQQQQLPSENGNVPPQQLLAESSSTSFGNEQEMPMDDETKEDQF
RSETTFSYTVENVGQIKQQHLSQPVYVRMLPWKIMVIPNDRALGFFLQCNGENDSPTWSC
NAIAELRLKCHKPDAPPFTRARIKHLFYSKENDYGYSNFITWQELQDPDKYYVNNGSITL
EVHVIADAPHGVLWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLAVYRIPTEADD
STKSVGLSLQRVFHELQFGDRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKM
KGTCLEGTIPGLFEGKMSSYIKCTNVDYNSTRYETFYDIQLNIKDKKNIYDSFQDYVASE
TLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPITDSSIKYNDRFEFYEQI
NLDRYLAEREKTPADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQE
AIEQNYGGMDDEISFHAKCSNAYMLVYIRQSELDRVLGDIPENEISSDLVERLDLEKRIE
MARRKERSEANLYVPIHVILEEYFESQQKRRLFDLEKTHQRPFKLKQNQTVNEMVEMLVK
AFGVPRDRMRMWNMCTAQSQKFLHFDFEAEAGRTIEQIPTSQKPWVIFLELAPPDSSVPL
LPFNPKTDVLLFLKYYDARNKRLNYIGCTQQPLCRRLSELVPEINRKLGFELDTELTVFD
EYADKKIPNINEPIENVLYMPQDHLQGPILIFERENVDAKLDLPTVEDYFLDLVYRIEII
FSDKCNPNEPDFTLELSNRYNYDQLTNAVAERLNTDPQKLQFFMCISNYKETAGNAVPYT
YKGTIKDLLSYTKQSTPKRIFYQRLSLSIHELDNKKLFKCIWVSNDLKEEKELVLYPNKN
DTVKGLLDEAAKTITFAENSRKKLRLLKVGNHKIVAICKDDIPLETLMKTNESITTTQGT
QKIYRIEEIPAEESQLAENELLIPVAHFSKELYNSFGVPFLTKARHGEPYGALKQRIQKR
LNVPDKEWENYKFAVITMGHTIDVNDNTSIDLEVYRTWTGGQLPFFGLDHINKSRKRSSL
NFSEKAIKIYN
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaaacagatcagtctatcgaagcaatggacacccaggatacccaagaggtc
gagataatcacaagtgacctacaacagcaacagcagcaacaacaacaacaacaacagcag
caacagcagcagcagcaacaacaacaacaacagacaaactcgccgccacaattgccaaag
tttaaaaatctgatacatccacagctgcagcaacagcagcaacaacagcaacagcagcag
cagctacccagtgagaacggtaacgtgccgccacagcaattgttggcagagagcagctcc
acatcatttggcaacgagcaagagatgccaatggacgacgaaacgaaggaggatcagttc
cgctcggagacaacgttctcctatacggtggagaatgtcgggcagataaagcaacagcat
ctgtcgcagccagtctatgtgcgcatgctgccatggaagataatggttataccgaacgat
cgtgcgctgggcttctttctgcagtgtaatggggagaacgattcgcccacttggtcgtgc
aatgccattgccgagctgcgtctgaaatgccacaagccggatgcgccgccgtttacgcgc
gctcgcatcaagcatttattctactcgaaggagaacgattatggttactcgaactttata
acctggcaggagctgcaggatccagataaatattatgtgaacaatggcagcattacgctg
gaggtgcacgtaattgccgacgcaccgcacggcgtgctgtgggactccaagaagcatacc
ggctatgtgggcctaaagaatcagggcgccacatgctatatgaattcgctgctccagacg
ctatattttacaaattcactacgtttggcggtttatcgcataccgaccgaggccgacgat
agcaccaaatcggtgggcctatccctgcagcgcgtcttccatgagctgcagttcggcgat
cgccctgtcggcaccaagaagctaaccaaatcgtttggctgggagacgctcgactcgttc
atgcagcacgatgtccaggagtttctccgcgtgctgctcgacaagctcgaatcaaagatg
aagggcacctgcctcgagggcacaattcccggcctgttcgagggcaaaatgtcatcgtac
attaaatgcacaaatgtcgattacaacagcacacgctacgagaccttctacgatattcag
ctaaatatcaaagacaagaaaaacatctatgactcatttcaggactatgtcgcctccgag
acactcgagggtgataacaaatacgatgccggtgtccatggtctccaagaggccagcaag
ggcgtcatattcacatcattcccgccggtgttgcatttgcatttgatgcgtttccaatac
gatccgattacagatagctcgatcaagtataacgatcgcttcgagttctatgagcaaatc
aatctggatcgttatctggcggagcgtgagaagacaccagccgactatgtgctgcacgct
gtgctggtgcattcgggcgacaatcatggtgggcattatgtggtctttatcaatccaaag
gccgatggtcgctggttcaaatttgatgacgatgtggtctccagttgccgcaaacaggag
gccatcgagcagaattatggcggcatggatgacgagatctcgtttcatgccaaatgcagc
aatgcctatatgctggtctatatacggcaatccgagttggatcgcgtattgggcgatata
cccgaaaatgagatatccagcgacctggttgagcgcctcgatttggagaagcgcatcgaa
atggcacgacgcaaggaacgcagcgaggccaatctgtatgtgcccatacacgtaatactc
gaggagtattttgagtcacagcaaaagcgacgcctcttcgatctggagaagactcaccag
cgtccatttaagctaaagcaaaaccaaactgttaacgaaatggtcgagatgttggtcaag
gcattcggtgtgccgcgcgatcgcatgcgcatgtggaacatgtgcacggcccaatcacaa
aagttcctgcattttgatttcgaggcggaggccggacgcaccatcgagcagatacccacc
tctcaaaagccgtgggtcattttcctggagctggcaccgcccgacagcagcgtgcccctg
ctgcccttcaatcccaaaacggacgtgctgctcttcctcaagtattatgatgcgcgcaac
aagcgcctcaattacattggctgcacacagcagccgctgtgtcgtcgcctcagcgaactg
gtgccggagattaatcggaagctcggctttgagctggacaccgagctgaccgtgttcgat
gaatatgccgataagaagatacctaatattaatgagcccatcgagaatgtgctatatatg
ccgcaggatcatttgcagggtcccattttgatatttgagcgcgagaatgttgatgccaaa
ctggatttgcccaccgttgaggattactttttggatctggtctatcgcatcgagatcatc
ttcagcgacaaatgcaatcccaatgagccggactttacgctcgagctatcgaatcgctac
aactacgatcagctaactaatgctgtcgccgagcgcctcaacacggatccccagaagctc
cagttcttcatgtgcatcagcaactacaaagaaaccgccggcaatgctgtgccctacacc
tacaagggtaccattaaggatctgttatcgtacacaaagcagagcacgccgaaacgtatc
ttctaccagagactgtccctgagcatacacgaactggataacaagaagctattcaagtgc
atttgggtttccaatgacctgaaggaggagaaggagctggtgctgtatccgaacaaaaat
gatacagtcaagggactactggatgaggctgccaagacaataacatttgccgagaatagc
cgcaagaagctgcgcctcttgaaggtgggcaatcacaagattgtcgccatatgcaaggat
gatataccgctagagacgctgatgaagacaaacgagtcgataacaaccacacagggcaca
cagaaaatctatcgcatcgaagagatacccgccgaggagtcacagctggccgagaacgag
ctcctcatcccggtggcccatttcagcaaagagctatacaattccttcggtgtcccgttc
ctcacaaaggcgcgacacggcgaaccgtacggggcgctcaagcagcgcatacagaagcgc
ctcaatgtgcccgacaaggagtgggagaactataagttcgccgttatcaccatgggccat
accattgacgtgaacgacaatacgtccattgatctcgaggtatatcggacatggactggc
ggccagttgccgttctttgggctcgaccacatcaacaaatcgcgcaagcgcagctcactc
aatttctccgagaaggcaatcaaaatctacaactaa

DBGET integrated database retrieval system