KEGG   Drosophila virilis: Dvir_GJ18689Help
Entry
Dvir_GJ18689      CDS       T01066                                 

Definition
GJ18689 gene product from transcript GJ18689-RA
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
dvi  Drosophila virilis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dvi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dvi00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2226 aa AA seqDB search
MDEANCYLVLEDGTVMPGWAFGAKSTPTSGEVVFQTGMVGYTEALTDRSYSAQILVLTYP
LIGNYGVPDVNQLDEFGLPEHFEWLQGAVQVAGLVVGEICDTPSHWRSQRTLSQWLAEHK
VPGISGIDTRALTKKLREQGSLLGRIVYEKPGKQLAPFEDPNQRNLAKECAVKEPLLYKS
PQTSGPRIAIMDCGLKLNQLRCLVQRGASVQLLPWSAELKEDQYDALFLSNGPGDPASCQ
PIVEQVKRVLQAGNKPIFGICLGHQLLATAIGCDTYKMKYGNRGHNLPCLHRATGRCLLT
SQNHGYAVDLAKLPADWEELFVNANDGTNEGIVHRTKPYFSVQFHPEHHAGPKDTEFLFD
VFLEAISQPQIGVPNLISRRLRVTQPEALPRPRKVLILGSGGLSIGQAGEFDYSGSQAIK
AMRESNIQTVLINPNIATVQTSKGMADKCYFLPLTPDYVEQVIKSERPNGVLLTFGGQTA
LNCGVELERAGVFAKYNVRILGTPIQSIIETEDRKLFAQRVNEIGERVAPSEAVYTVAEA
LDAAGRLGYPVMARAAFSLGGLGSGFANNEQELRTLAQQALAHSNQLIVDKSLKGWKEVE
YEVVRDAYDNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGV
VGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLSLGEPLPEIRNS
VTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSMKSVGEVMAIGRSFEEAFQKAL
RMVDGDVQGFDPYLAPVEKEQLSEPTDRRPFVLAAALRAGMCIEELHELTKIDRWFLHKL
HHIIQFYGQLESAGSQLTPALLLSAKRLGFADKQIAMATKSTELAVRQQRHEHNIRPYVK
QIDTVAGEWPASTNYLYNTYNASEHDVLFPGGHTIVVGSGVYRIGSSVEFDWCAVGCLRE
LRNLKKSTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMERSDGIILSMGGQLPN
NIAMDLHRQQAKVLGTSPESIDCAENRFKFSRMLDRKGILQPLWKELTNLQSAVEFCQEV
GYPCLVRPSYVLSGAAMNVAYSDQDLETYLNAASTVSREHPVVISKFLTEAKEIDVDAVA
ADGQILCMAVSEHVENAGVHSGDATLVTPPQDLNAETLEAIKRITRDLASVLDVTGPFNM
QLIAKNNELKVIECNVRVSRSFPFVSKTLDHDFVATATRAIVGMDVEPIDVLHGVGKVGV
KVPQFSFSRLAGADVQLGVEMASTGEVACFGDNRYEAYLKAMMSTGFQIPKNAILLSIGS
FKHKMELLSSIRDLAKMGYKLYASMGTGDFYAEHGVDVESVQWTFDKTTPDDINGELRHL
AEFLANKQFDLVINLPMRGGGIRRVSSFMTHGYRTRRLAVDYSIPLVTDVKCTKLLVESM
RVTGRNPGMKTHTDCMTSRRIVKLPGFIDVHVHLREPGATHKEDFASGTAAALAGGVTMV
CAMPNTNPAIVDRETFNQFRELARAGARCDYALYVGASDTNWEHAHELATQACGLKMYLN
DTYGTLRLSDMAAWQRHLSRWPKRAPIVCHAERQSMAAVMLLAHLLERPIHICHVARKEE
IQLIRAAKEKGMKVTCEVCPHHLFLSTRDLERLGAGMAEVRPLLCSPEDQEALWEHMEYI
DVFATDHAPHTLAEKQSERPPPGFPGLETILPLLLQAVHEGRITLEDIKRKFHRNPRNIF
NLPEQPQTYVEIDLDEEWTISNNELKTKARWTPFHGTKVKGRVHRVVLRGEVAYIDGQVL
VQPGYGQNVRSKLPLPQKSETEGNDLPSDTDVNDTFSRLLTEGTGTATGTGATGSRATSV
HFVDEAGASTSPAAGSILRPVSPAPRLRLDSSSNATLKEYLQKNSLLPTPNPVAHCLVGK
HVLSVDTFDKERLNDIFNLAQLLKSRVTKDRPVDDLLRGKIMASIFYEVSTRTQCSFSAA
MQRLGGHVINMDQVTSSVKKGETLEDSIKVMASYADVLVLRHPEPGAVARAASFSRKPLI
NAGDGVGEHPTQALLDVFTIREEIGTVNGLTITMVGDLKNGRTVHSLASLLTLYNITLQY
VAPPGLGMPEPIMRYLQQRGVTQLTFDSIEQALPTTDVLYMTRIQRERFKSEEEYQRCCG
HFIVTPKMMTRANKRTIVLHPLPRVEEISRDFDSDPRAAYFRQAEYGMYIRMALLAMVVG
CRSTAL
NT seq 6681 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagcgaattgttatcttgtgctggaggatggcaccgtgatgccgggctgggca
ttcggcgctaagagtacgcccacaagcggagaggtggtgttccaaacgggcatggtcggc
tacacggaggccttgacggatcgctcgtacagtgcgcagattctggtcctgacctatccg
ctaattggcaactatggagtgccggatgtcaaccaactggacgagtttggactgccggag
cactttgagtggctgcagggcgccgtccaggtggccggcctggtggtgggcgagatttgc
gacacgccctcgcattggcgttcacagcgcacgctgtcccagtggctggcggagcataag
gtgcccggcatcagcggcatcgatacgcgcgccctgaccaaaaagctgcgcgaacagggc
agcctgctgggccgcattgtctatgagaagccgggcaagcagctggctccgttcgaggat
cccaatcagcgcaatctggccaaggagtgcgccgtcaaggagccgctgctgtacaagtcg
ccgcagacgagcggaccacgcattgccatcatggattgcggcctgaaactgaatcagctg
cgctgtttggtgcagcgcggcgcgtccgtgcagctgctgccctggagcgcagagctgaag
gaggatcagtacgatgcgctgtttctatcgaatggaccgggcgatccggccagctgccag
ccgattgtggagcaagtgaagcgcgttctgcaggctggcaacaagcccatctttggcatc
tgccttggccatcagctgctggccacggccattggctgcgacacctacaagatgaagtac
ggcaatcgtggccataatttgccctgtctgcatcgcgcaactgggcgctgtctgctcacc
tcgcagaatcacggctatgccgtcgatctggccaagctgcccgccgactgggaggagctg
tttgtcaatgccaacgatggcaccaacgagggcattgtacaccgcaccaagccctacttc
tcggttcagttccatccggagcatcatgccggtcccaaggataccgagttcctcttcgat
gtcttcctcgaagctataagccagccgcaaataggcgtgcccaatctaatctcgcgtcgg
ctgcgcgtcacccagcccgaggcgctgccgcgacctcgcaaggtgctcatattgggctct
ggcggcctgtcgattggccaggccggcgaattcgactattccggctcgcaggccatcaag
gccatgcgcgagtcaaacatacagacggtgctgatcaatcccaacattgccaccgtccag
acgtccaagggcatggcggacaagtgctatttcctgcccctgacacccgactatgtggag
caggtcatcaaatcggagcggcccaacggcgtcctgctcacctttggcggccagacggca
ctcaactgcggcgtcgagctggagcgtgccggcgtctttgccaagtacaatgtacgcatc
ctgggcacgcccatacaatcgatcatcgagacggaggatcgcaagctgttcgcccagcgt
gtcaatgagattggcgaacgtgtggcgccatccgaggcggtgtataccgtggccgaggcc
ctggatgcagccggccgcttaggttatccggtgatggcacgtgccgccttctcgttgggc
ggcctgggctccgggtttgccaacaacgagcaggagctaaggacgctcgcccagcaggcg
ctcgcccattccaatcagctaattgtggacaagtcgctcaagggctggaaggaggtggag
tacgaggtggtgcgtgatgcctacgacaattgcatcacggtctgcaacatggagaatttc
gatccgctgggcatacacacgggcgagagcattgtggtcgcgccctcgcaaaccctctcc
gatcgcgaataccaaatgctgcgcagcaccgccctcaaggtaatccggcacttcggcgtc
gtcggcgagtgcaacatacagtatgcgctctgcccgcactcggagcagtactacatcatc
gaggtgaacgccagactgtcgcgcagctcggcgctggccagcaaggcgaccggctacccg
ctggcatatgtcgccgccaagttgtcgctgggcgagccgctgccggagatccgcaactcg
gtgacgggcaatacgacggcctgctttgagcccagcctggactactgtgtggtgaagata
ccacgctgggatttggccaaattcgtgcgcgtcagcaagcacattggcagctccatgaag
agcgtcggcgaggtgatggccattggccgcagcttcgaggaggcattccagaaggcattg
cgcatggttgacggcgatgtccagggcttcgatccgtatctggcgcccgtcgaaaaggag
cagctatcggagccgacagatcgtcgtccctttgtgctggccgctgccctccgggcgggc
atgtgcatcgaggagctgcacgagctgaccaaaatcgatcgctggttcctgcacaagctg
caccacatcatccagttctatggccagctggagtcggctggcagtcagctgaccccggcc
ctgctgctcagcgccaagcgcctgggcttcgcggacaagcagatcgctatggccaccaag
agcacagagctagccgtgcgccagcagcgccacgagcacaacattcgcccctacgtcaag
cagattgataccgtggcgggcgaatggcccgccagcaccaattacctatacaacacgtac
aatgcatccgagcatgatgtcctctttcccggcggccatacgattgtcgtcggctcgggc
gtctatcgcattggctcctccgtggagttcgattggtgcgccgtcggctgcctgcgggag
ctgcgcaatctaaagaagtcgaccatcatgattaactacaatccggaaacggtgtccacc
gactacgacatgtgcgatcgcttgtactttgaggagattagctttgaggtcgtcatggat
atctacgagatggagcgctccgatggcatcatactctcgatgggcggccagctgccgaac
aatattgccatggatctgcataggcagcaggccaaggtgctgggcacctcgcccgagtcg
attgattgtgccgagaatcgtttcaagttctcgcgcatgctggacagaaagggcatcttg
cagccgctgtggaaggagctgaccaatctacagtcggccgttgagttctgtcaggaggtg
ggctatccgtgcctggtgcgaccctcctatgtgctctcgggtgcggccatgaatgtggcc
tactcagatcaggatctggagacatatctgaatgccgcttcgaccgtgagtcgcgagcat
cctgtggtcatatccaaattcttgaccgaagccaaggaaatcgacgtggacgccgttgca
gccgatggccaaatcttgtgcatggccgtctccgagcatgtggaaaacgcgggcgttcat
tcgggcgacgcgacgctggtcacgccgccgcaggacttgaatgccgagaccctggaggcc
atcaagcgcatcacacgcgacctggccagcgtcctggatgtcaccggacccttcaacatg
cagctcattgccaaaaacaatgagctaaaggtcatcgaatgcaatgtccgtgtctcgcgc
tcctttcccttcgtatcaaagacactcgaccatgattttgtggcgacggccacacgagcc
attgttggcatggacgtggagcccatcgatgtgctccacggcgtcggcaaggtgggcgtc
aaggtgccacagttcagtttctcgcgactcgccggtgccgacgtccagctgggcgtcgag
atggcctccaccggcgaggtggcctgctttggcgacaatcgctacgaagcctacctaaaa
gccatgatgtccaccggcttccagatacccaaaaatgccattctgctatccattggcagc
ttcaagcacaaaatggagttgctttcctccattcgagatctggccaaaatgggctacaag
ctgtacgcctcgatgggcaccggtgacttctacgcggagcacggcgttgacgtcgagtcc
gtacagtggacattcgataagacaacacccgatgatatcaatggagagctgcgacacttg
gccgagtttctggccaacaagcaatttgatctggtcatcaatttacccatgcgtggcggc
ggaatccgcagggtctcatcattcatgacgcatggctatcggacacgtcgcctggcggtt
gactattccataccgctggtgacggacgtcaagtgcaccaagctgctggtggaatcgatg
cgtgtgactggtcgcaatccgggcatgaagacgcatacggactgcatgacgtcgcgtcgc
attgtgaagctgccgggcttcatagacgtgcatgtgcatctgcgggagccgggcgccacc
cacaaggaggacttcgccagcggcaccgcagccgctctagccggcggcgtcacaatggtc
tgtgccatgcccaacacgaatccggcaattgtggatcgcgagacgttcaatcaattccgc
gagctggcccgagccggggcccgctgtgactatgcgctatatgtgggcgcctcggacacc
aactgggagcacgctcatgagctggccacgcaggcgtgcggcctgaagatgtaccttaac
gatacgtacggtacgctgaggctcagcgacatggccgcctggcagcgtcacctgtcgcgc
tggcccaagcgggcgcccatcgtttgtcatgcggagcggcagagcatggcggctgttatg
ctgctggcccatctgctggagcgacccatccacatctgccatgtggcgcgcaaggaggag
attcagctgatacgtgccgccaaggagaagggcatgaaggttacctgcgaggtgtgtcct
catcatctgttccttagcacgcgcgatctggagcgtctgggcgccggcatggcggaggtg
cgaccgctgctgtgctcgcccgaggatcaggaagcgctctgggagcacatggagtacatt
gatgtgtttgccacagatcatgcgccgcacacgctagccgaaaagcaatcggagcggccg
ccgcccggtttccccggcctggagactatattgccgctgctgctgcaggccgtgcacgag
ggtcgcatcaccctggaggatattaagcgcaagtttcatcgcaatccgcgcaatattttc
aatttgcccgagcagccgcagacctatgtggagattgatctggacgaggagtggaccatc
agcaacaatgagctgaagaccaaagcccgctggacgcccttccacggcaccaaggtgaag
ggtcgcgtccatcgcgtcgtgctgcgcggcgaggtcgcctacattgatggccaagtgctg
gtccagcccggctatggccagaatgtgcgctctaagctgccgctgccgcaaaagtccgag
accgaaggcaacgacctgcccagcgataccgatgtcaacgacaccttctcgcgcctattg
accgagggcaccggcactgcaactggcaccggcgccacgggttcacgcgccaccagcgtt
catttcgtggacgaagctggcgcaagtacatcgccggcggcgggcagcatcttgcgtccg
gtgtcgccggcgccacgactgcgtctcgactcgtccagcaatgccacgctgaaggagtat
ctgcagaagaactcgctgctgcccacgccgaatccggtggcgcactgcttggtcggcaag
catgtgctctccgtagacaccttcgacaaggagcgcctgaacgacatattcaatttggcg
cagctgctgaaatcgcgcgtaaccaaagaccggcccgttgacgacttgctgcgcggcaaa
atcatggccagcatcttttacgaggtgagcacacgcacccagtgcagctttagtgcggca
atgcagcgcctgggcggacatgtcatcaacatggatcaggtcacctcgtcggtgaagaag
ggcgaaacactcgaggacagcatcaaggtgatggccagctatgcggatgtcctagtgctc
cgtcatcccgagccgggcgccgtcgcgcgcgccgcttcgttttcgcgcaagccgctaatc
aatgccggcgacggagtcggtgagcatcccacgcaggcgctgctggacgtcttcaccata
cgtgaggaaattggtaccgtcaatggtctaacaatcaccatggttggcgacctcaaaaac
ggacgcaccgtccactcgctggcaagtctgctcaccctctataatatcacgctgcagtac
gtggctccgccgggcctcggcatgcccgagcccattatgcgctatctgcagcaacgcggc
gtcacgcagctaacgttcgacagcatagagcaggcgctgcccaccaccgatgtgctctac
atgacacgcatacagcgcgaacgcttcaagagcgaggaggaataccagcgctgctgcggc
cactttattgtcacgcccaaaatgatgacacgggcaaataagcgtaccatagtgctgcat
ccgctgccgcgcgtcgaggagatcagccgcgactttgactcggatccacgtgcggcctac
ttccgacaggctgagtacggcatgtacattcggatggcgttgctggccatggtcgttggc
tgtcgcagcacggcgctctga

DBGET integrated database retrieval system