KEGG   Drosophila virilis: Dvir_GJ18839Help
Entry
Dvir_GJ18839      CDS       T01066                                 

Definition
GJ18839 gene product from transcript GJ18839-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dvi  Drosophila virilis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ18839
   04068 FoxO signaling pathway
    Dvir_GJ18839
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dvir_GJ18839
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dvir_GJ18839
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dvir_GJ18839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 397 aa AA seqDB search
MSKNKLNLVLPPVNVDTTVAATQVAPTPPFKTPSGTETHSLLGKPKTSIDALTETLEGLD
MDDTERKRIKVFLSQKEKIGELSEEDLEKLGELGSGNGGVVMKVRHTLTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPDSSTLETIFAENANE
DGNQTVLEPKVMAIFELLDYIVNEPPPKLEHKIFSNEFKDFVDICLKKQPDERADLKTLL
SHPWIRKAEVEDVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaataaactgaatttagtgctgccgccggtaaatgtggatacaactgttgct
gccacacaggtggcaccaacaccgccatttaaaacaccatcgggaacagaaacacatagc
ttgctggggaagccaaaaacgagcatcgatgcgctaacggaaacattggagggcctggac
atggatgacacggaacgcaaacgaataaaagttttcctcagtcagaaagagaaaatcggc
gaactctccgaggaggatctcgaaaagttgggcgaactcggctccggcaatggcggcgtt
gttatgaaagtgcgccacaccctcacacatctaattatggcacggaaactgatccatctg
gaggtgaagccggcgatcaaaaaacaaatcctgcgcgagctaaaagtgctgcacgaatgc
aattttccccacattgttggcttctatggcgccttctacagcgacggtgagataagcatc
tgcatggaatacatggacggcggctcccttgatctcatattaaagcgcgccggccgcata
cccgaatcgatactcggacgcatcacgctggcggtgctgaaggggctcagctatctgcgg
gacaagcatgcgatcatccatcgcgatgtaaagccaagcaatatactcgtcaacagcagc
ggcgagatcaaaatctgtgatttcggcgtttcgggtcagctaatcgactcgatggccaac
tcatttgtgggcacgcgcagctacatgtcgccggaacgactgcagggcacacactactcg
gtacagtcggacatttggtcgctgggtctgtcactggttgagatggccatcggcatgtat
ccaataccgccgccggattcgtcaacgctggagaccatattcgcagagaacgccaatgag
gatggcaatcaaacggtgctggagcccaaagtgatggcaatattcgagctgctcgattat
attgttaacgagccgccgccgaagctggaacacaagatattctcaaatgagttcaaggac
tttgtcgacatctgtctcaaaaagcagccggacgagcgtgccgatctcaagacgttgttg
agccatccatggatacggaaagcggaggtggaggatgtcgacatatcgggctgggtatgc
aagacaatggacttgccgccatcgacgccgaaacgcaatacatcgcccaactaa

DBGET integrated database retrieval system