KEGG   Drosophila virilis: Dvir_GJ18890Help
Entry
Dvir_GJ18890      CDS       T01066                                 

Definition
GJ18890 gene product from transcript GJ18890-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dvi  Drosophila virilis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dvir_GJ18890
  Lipid metabolism
   00062 Fatty acid elongation
    Dvir_GJ18890
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dvir_GJ18890
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dvir_GJ18890
Lipid biosynthesis proteins [BR:dvi01004]
 Fatty acid synthase
  Component type
   Dvir_GJ18890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 309 aa AA seqDB search
MRLLVSALYLISCLHFGQANITDGNNNDNGNGNILPVVLWHGMGDTCCFPFSLGSIKKLI
EEHTNGTYVRSLEIGANIVLDYESGFFIHPNKQVDYVCQQLARDEKLANGYNAIGFSQGG
QFLRALAQRCPTPPMRVLISLGGQHQGVYGVPKCPTLSVSSCEYITRLLNYAAYDEWVQN
GLVQATYWHDPLHENSYRLKSSFLADINNELYINERYAENLNKLKRFVMVKFLNDTIVQP
KESQWFEFYAPGQDKHILPLSESKVYKNIGLDEMKQRGKLQFLSVEGDHLAISKEWFIKE
LVPLLLELA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcggttactggtcagtgcactttatttgattagctgcttgcactttggtcaagccaat
ataacagacggcaacaacaacgacaatggcaatggcaatattctgcccgtggtactgtgg
catggcatgggcgacacttgttgttttcccttcagcctgggctccattaagaagctgatc
gaggagcatacgaacggcacctatgtgcgttccttggagataggcgccaatatcgttttg
gattatgagagcggcttcttcatacatccgaacaagcaggtcgactacgtctgtcaacag
ctggcacgtgacgaaaagctggccaatggatacaatgccatcggtttctcgcagggcggt
caatttttgcgagcgctggcacagcgttgtcccacgccgccaatgcgagtgctcatcagc
ttgggcgggcagcatcagggcgtctatggagtgcccaagtgtcccacgctaagcgtcagc
agctgcgagtacattaccaggcttctgaactatgctgcctacgatgagtgggtccaaaat
ggtctggtgcaggctacctactggcacgatccgctgcatgagaatagctatcggctgaag
agcagctttctggccgacatcaacaacgagctgtacattaatgaacgctatgcagagaat
cttaacaagcttaaaagatttgttatggttaaattcctcaacgacaccattgtgcagcct
aaggagtcgcagtggtttgaattctatgcacctggtcaggacaaacacatactgccgctt
agcgaaagcaaagtttacaagaatattgggctggacgaaatgaaacagcgcggaaaactg
cagtttctcagcgtcgaaggcgatcatctggccatatcaaaggagtggttcatcaaggaa
ctggtgcccctgctcctagaactagcataa

DBGET integrated database retrieval system