KEGG   Drosophila virilis: Dvir_GJ19054Help
Entry
Dvir_GJ19054      CDS       T01066                                 

Definition
GJ19054 gene product from transcript GJ19054-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dvi  Drosophila virilis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dvir_GJ19054
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     Dvir_GJ19054
Glycosyltransferases [BR:dvi01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dvir_GJ19054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 747 aa AA seqDB search
MAASVVKAPKCTRKPKDLPKTEPARLNDDNWRWWAFMGAVLLITFATRFYKVTEPDHICW
DETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNETRYQGM
RYFCTTLGALIMPMGFDTVYDLTRSHEAALLSAAYLIFDVGMLTLNQYILLDPILLFFMM
GSVWGMVKISKCTAAGGSYTARWWLWLLLTGTMLSCTISVKFVGLFVVLLVGLHTASELW
MILGDLRKPIVETGKQIACRAVALIIWPILLYTFFFYIHLSVLNRSGNGDGFYSSAFQSR
LIGNSLYNASMPRDVAYGSLVTIKNHKTGGGYLHSHAHLYPKGSGARQQQITTYTHKDDN
NIWLIKPYNKPALPKDELRLLQHGDLLRLEHLVTKRNLHSHSEPAPMTKKHLQVTGYGEL
GVGDANDVWRVLIVGGKPNETIHTVTSRLMFVHYLQNCALTSSGKQLPKWGFEQQEVSCN
LNVRDKNAQWNVEDNQHKLLPSVSFSIYAPGFFARFLESHAVMLQGNAGLKPKEGEITSQ
PWQWPINYRGQFFSGTSYRIYLLGNPIIWWSNLIFLLLFVVVFLYNAVLEQRRAGQAALH
ATGQPEELAATTELCSCCPAGSDQQKSAEDTTTTGLSDSAMSLRAAAWLFIGWLLHYLPF
WAMGRVLYFHHYFPALIFNSLLTGIMFNYIIRSLPRWLQHVLLGTLLSVLVYSFVLFSPL
AYGMSGPLANEPNSTMHNLKWLATWEF
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaagtgttgttaaggcgcccaaatgcacaaggaagccaaaagatttgcccaaa
acagagccagcccggctcaacgatgacaattggcgctggtgggcattcatgggcgcggtg
cttcttattacctttgccacacgcttctataaggtaaccgagccggatcatatctgttgg
gacgagacgcatttcggcaaaatgggcagctggtacattaaccgcaccttcttcttcgat
gtgcatccgccgctggggaagatgctgattggtctttccggctatttgacgggctacaac
ggaacctttccattcgagaagcctggcgacaagtacaacgagacgcgctatcagggcatg
cgctatttctgcacaacgctgggcgcactcatcatgcccatgggcttcgataccgtctac
gatctgacgcgctcccacgaagcggctctgctgtcggccgcgtatctgatctttgatgtg
ggcatgctgacgcttaatcagtacatactgctggatccgatactgctgttcttcatgatg
ggctcggtatggggcatggtcaagatatcgaagtgcacagccgcgggcggctcctatacg
gcacgctggtggctgtggctactgctcaccgggacaatgctctcctgcacgataagcgtt
aagtttgtgggcctgtttgtggtgctgctggtgggtttgcacacggccagcgagctctgg
atgatactgggtgatctgcgcaagcccattgtggagacgggcaagcagatagcgtgccgc
gctgtggcgctcattatctggcccatactgctgtacacgttcttcttctacatacatctg
agcgtgctgaatcgcagcggcaacggggatggcttctacagctcggcgtttcagtcgagg
cttattggcaactcgctgtacaatgcgagcatgccgcgagacgtggcctacggctccttg
gtgaccatcaagaatcataagactggcggcggctatctccactcgcacgctcatctctat
cccaagggcagcggcgctcgtcagcagcagatcaccacctatacgcacaaggatgacaac
aacatctggctgatcaagccgtacaacaagccagccctgcccaaggacgagctgcgtctg
ctgcaacacggcgatctgttgcgcctggagcatctggtgaccaagcgcaatctgcactcg
catagcgagccggcgcccatgaccaagaaacacctccaggtgaccgggtacggcgagctg
ggtgtgggcgatgccaacgatgtttggcgcgtgctcatcgtgggtggcaagcccaatgag
accatacacacggtcacctcacggctcatgttcgtccactatctgcagaactgtgcgctc
acgtccagtggcaagcagctgcccaaatggggctttgagcagcaggaggtctcctgcaat
ctgaacgtgcgcgacaagaatgctcaatggaacgtggaggacaatcagcacaagctattg
cccagtgttagctttagcatctacgcgccgggcttctttgcacgcttccttgagtcccat
gcggtcatgctccagggcaatgctggcctcaagcccaaggagggtgagatcacaagccag
ccctggcaatggcccattaactatcggggtcaatttttctctggcaccagctatcgcatt
tatttgcttggcaatcccatcatctggtggagcaatctcatctttttgctgctcttcgtc
gtcgtcttcctgtacaacgccgtgctggagcagcgccgtgccggccaagcagctctccac
gccactggccagcccgaggagctggctgccacaaccgaactgtgcagctgctgtccagct
ggcagcgatcagcagaaatcagctgaggacacgaccacaactggactgagtgactcggcc
atgtccttgcgggcagctgcctggctgtttatcggctggttgctgcactacttgcccttc
tgggccatgggtcgagtgctctactttcatcactatttcccggcattaattttcaactct
ttgctcacgggcattatgttcaactacattatacgatcgctgcccaggtggctgcagcat
gtgctgctgggcacgttgctctcggtgcttgtctatagctttgtgctcttctccccgctg
gcctatgggatgagcgggccgctggcgaatgagcccaattccacgatgcacaacctcaag
tggctggcgacgtgggagttttag

DBGET integrated database retrieval system