KEGG   Drosophila virilis: Dvir_GJ19060Help
Entry
Dvir_GJ19060      CDS       T01066                                 

Definition
GJ19060 gene product from transcript GJ19060-RA
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dvi  Drosophila virilis
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dvir_GJ19060
   04330 Notch signaling pathway
    Dvir_GJ19060
   04350 TGF-beta signaling pathway
    Dvir_GJ19060
   04630 Jak-STAT signaling pathway
    Dvir_GJ19060
   04068 FoxO signaling pathway
    Dvir_GJ19060
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dvir_GJ19060
Transcription factors [BR:dvi03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dvir_GJ19060
Mitochondrial biogenesis [BR:dvi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dvir_GJ19060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3142 aa AA seqDB search
MMADHLDEPPQKRAKIDQSTLRFLEENLPDELVSSNSGWSDQLSTTGGGVNVVSTATGVG
TGGPNKPPTQGPGSGVVPPQMNGAGGGGDDGSGNAGSGAAGSQLRQMQHHQHLQHFLQQQ
QQGNKGAGGGMVVPGMNQLGSKSPSLQSPNTGGIQVTTQMGMVNSMPMSISNNGNNGMNA
IPGMNSIAQGNLGNMVLTNSGGMGTIGGTGLVNTLKQPVAASLMNAVPGSVGVSSVSGAA
PSQGMHMQNGPMMGRMVGQQHLLRGPHLMGAGASGGSGPGGVVGVGGGPRMQNPNMQLGQ
INNMPYGVGNYGTPSSNNPQQQQQLLAQQMAQRGGGGVVAPNMSAGMPQGNRPIGTVVPM
SSLGGDGPPPGSGGLVGNPQQQQQLAAANAQMNPQQQQQPPSAQQSALGPRAPQPNQLLG
HSQQQQQQPGTSQQQAISSGVASSVSGPAPAPGSMSDERKKQIQQHLMLLLHAHKCNRRE
NMNPNREVCSVNYCKAMKAVLAHMATCKQSKDCTMQHCTSSRQILLHYKTCQRSDCIICY
PFRQNHSLFQNASGAGGGPTGAANASPLQQQQQQQQLAQGQPQVSQNPSGVGVGVGVGVD
SKQVAQSTGTGGTQNTAIVLPQQQTPGATNVPKSNTDLAQQQQQQVQQQELRRFESVGSI
GQVGPVSAGMLGVPGQGMPPGIRMQGTPSVRVLGVQPGAGGAISGGVPVPGQNVLPGAND
VTSLQQQQAQAAQQGGQLMLQGCNTSTGRRRAIPNMVEQQPNAQQSVQQQQQLGNIPAPL
SVNVGFNNANFVGVGEKQQLGSQSDQMAKLKLQAQSQAQVQAHVSVVSAGAPGTGNSTAG
ASVLMPADTTGVANSSSSGSNSSNAGAGSAGSAGGAGGAPGSGSDSEKDWRESVTADLRN
HLVHKLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQ
KELEEKRLKRKEQHQQQMLQMQQGGPNSGVVNPTSVPNNSLQQQPGQGVRPIISPMGSGG
GGPSGMVQQQMRPQAPGMGSGASQQQTAAGQANMVAVAASMRSHSPGGNMLAIQQQQQRM
QFPQQQQPVQGNMLVGPSGPSPGGMVANPVLSPFNTQQTMQSASSVGGGPGILTSPVTAQ
QQQQQQQQQQQQQQQQQFINANGSSGGQNSQISEIMKQRLLQQHQQQTNAAMLLPQSPFS
NATPIQQPQQLQQQSNAFNSPMQQKAQQPPGSVLNNMPPTPTSLDALTAGAPNAGAGGIG
SGTVTAPSPSPSFMSNGPIGTPSNNPPSVSSLMQPLSNRAATPPYIPTSPVPATSASGLA
ASSTPASAAATCANSGSSSNISSTSSSVITTTAVTAVVSTPISCASGATQTSTTATSGNV
NSTPVSSTVLLVARSNSDNTATGRVMSTSSSLSSQMAALEAAARDNDDETPSPAGANDTN
GSNGGGSSGGGGMSSKGKLDSIKQEDEIKKEFMDDSCGGNGDSSQMDCSTGGKGKNVNND
GTSMLKIDLKSEDGAAGDVKIKSEPMDVDESAVVGGIATGANGDGGGGSDGKDDINGAID
GVSAGIASDIKIKSETKPMVPEPLAPNAGDKKKKCQFNPEELRTALLPTLDKLYRQEPES
VPFRYPVDPQALGIPDYFEIVKKPMDLGTIRNNILNGKYSDPWEYVDDVWLMFDNAWLYN
RKTSRVYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYY
SYQNSLKEYGVASNRYTFCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELE
PFVDCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYI
ETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEGGEMMQEFPYRAKALFAF
EEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMD
YVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDY
KDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLF
SAEDNEVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSAKIYATMEKHKEVF
FVIRLHSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHYEFSSLRRAQFSTLSML
YELHNQGQDKFVYTCNNCKTAVETRYHCTVCDDFDLCTVCKEKVGHPHKMEKLGFDLDDG
SAPADLKQANPQEARKQSIQRCIQSLVHACQCRDANCRLPSCQKMKRVVQHTKNCKRKTN
GGCPICKQLIALCCYHAKHCQEQKCPVPFCPNIKLKLKQQQLQQKLQQQQLLRRRVALMS
RTAAPTALPGPAVSGPVVAAGGVGVGVPVVGMSGVAVSQQVMSGPASILPSSGGGMSPST
VPVPSPVSGAVIAGMTSPHPHQPGIGMKPGGHSPSPNVLQVVKQVQEEAARQQVPHGGSF
GKGVPMAPPVMQRPMGVGVPNQGAMGGMVGNQLTGNVGVVPGGGQMPSGGNCNNVLNSNN
LLPMDQWGGGGGPQQRYANNTPNQQGMRQPNQLMQQNIQQQQMLGIPSNQLGVGVGVGGS
VGTGQMPVVGAGVSMGGGGAAHGIGLGAPIGAATSGGGVRPPGAQGVGGGGTGGAGPNMV
NGPPLNTQTLAQIMQKIKNNPTNESNQHILSILKQNPQIMAAIIKQRQQSQINAAAGGAG
GAGGALQAGNGPQTPQQQQQQQQVMQQQQMQHMMNQQQQGPGPGPQQMGPGQQQQVSLMQ
GAQQPQQGPPHQRMANMQNTAMMLPNLPPGITNQGGMVPNQNWTKMRYMQMNQYPPPYPQ
RQRGPHMGVAGQPQFPGGTTGNFNAGSAGNVTGVQVAGTTVGSGAAGTVSDQYSMANAAA
SNMLQQQQTVGGAGVKPVPQQQQQQMGVIPPGMQQQPMQQQQQQQMMQAVAAGGGGMTGT
NPQNALPGGSSGPTGPGSNVMGPPTPHTLQQQLMQTARSSPPIRSPQPTPSPRSAPSPRG
PSASPRAQPSPHHVMSSHSPAPQGPHDGLHNHGMHHQSPLPAVPQDVGVSGVSVGVNAGN
VGNAGGSLPDASDQLSKFVERL
NT seq 9429 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcatttggacgaaccgccacaaaagcgggctaagatagatcaatcgact
ctacgctttctggaagaaaatctacccgatgagttggtttcctcgaacagtggatggtca
gatcagcttagcactactggtggcggcgttaatgttgtatccacagcaaccggcgtcggc
actggcggaccaaacaaacctcctactcagggacctgggtcaggcgttgtgccaccacaa
atgaatggagccggtggcggcggggatgatggcagtggtaatgccggtagcggcgctgct
ggtagtcaactacgtcaaatgcaacatcaccagcatttgcagcattttttgcagcaacag
cagcaaggtaacaaaggcgctggcggtggcatggttgtgcctggcatgaatcaactaggc
agcaaatcacccagcttgcaatcgcctaacacgggtggcatacaagtgactacacaaatg
ggcatggttaattctatgcccatgtccatatcaaataatggcaataatggcatgaatgct
ataccaggcatgaacagcattgcacagggaaatcttggcaatatggttctgacaaacagt
gggggcatggggaccataggtggcacgggcttggtcaatacactgaagcaacctgtcgct
gcctccttgatgaacgcagtgcccggatcagtgggtgtgagctccgtatccggtgcagcg
cctagtcagggtatgcacatgcaaaatggtccgatgatgggacggatggttggacagcaa
cacttgcttcgtggtccgcatttaatgggcgctggagctagcggaggcagtggcccgggt
ggtgttgttggcgtcggtggcggtcctcgaatgcaaaacccaaacatgcagctgggccaa
attaataatatgccttacggagtcggtaactatggtacacctagcagtaacaatccgcag
cagcagcaacagctacttgctcagcagatggcacagcggggtggcggcggcgtcgtagca
cccaatatgagcgcgggaatgccccaaggaaaccggccaattggcacagttgtaccaatg
tccagtctgggtggagatggaccgccacctggctcaggcggactcgttggaaatccccaa
cagcagcaacaattagcggcagcaaacgcacaaatgaatccccagcagcaacagcaaccg
ccgagtgcgcaacaaagtgcactgggaccacgcgcgccgcaacccaatcaactgttagga
cattctcagcaacaacagcagcaaccaggaacatctcagcagcaagcaatttcatctgga
gtggcttcgtctgttagcgggcctgctccggcaccaggcagcatgtctgatgaacgcaag
aaacaaatacagcagcatttgatgttgttattgcatgcccacaagtgcaaccggcgcgag
aacatgaatcccaaccgtgaggtctgcagtgtcaactattgcaaggccatgaaagccgtg
ttggcccatatggccacatgtaagcagagcaaggactgcaccatgcaacattgcacctct
tcgcgccagatactgctccattacaaaacctgccaacgctccgattgcatcatttgctat
ccttttcgccagaatcactcgctgtttcagaacgctagcggcgcaggaggtggtcctacc
ggagcagccaacgcatcacctttacagcagcaacaacaacagcagcaattagcacaaggc
caaccacaggtttcgcaaaatccgtctggcgtaggtgtcggtgttggagtcggcgtcgat
agcaaacaagtggcacagagtactggaactggcggcacacaaaatacggcaattgtgtta
ccgcagcagcagacgcccggcgcaaccaatgtacctaagagtaatacggacttggcacag
cagcagcagcagcaggtgcaacaacaagagcttcgacgctttgagagtgttggcagtata
ggccaagttgggccggtctcagctgggatgttgggtgtgccggggcaagggatgccaccg
ggtattcgtatgcagggcactccatctgttcgcgtgcttggtgtacagcctggagcaggt
ggtgcaatatctggcggagtgcctgtacccggacaaaatgttttacccggggcgaacgat
gtgaccagtttacaacagcagcaggcgcaggccgcacagcagggtggacaactaatgctg
cagggttgcaatactagcactggacgcaggcgcgcgattcccaatatggttgaacagcag
cccaatgcgcagcaaagtgttcaacaacaacagcaattgggcaacattccagcgccactg
tcggtcaacgttggttttaataatgccaactttgtaggcgtcggcgaaaagcaacaacta
gggagtcagtcggatcagatggctaagctcaaattacaggctcaatcgcaagcacaggta
caggcacacgtcagcgtagtgtcagcaggcgcgccaggtactggcaatagcacagctggt
gctagcgttttgatgcctgcagataccacaggagttgccaacagttcatcaagtggatca
aattcatcaaacgcgggagcgggaagcgcaggcagcgctgggggtgcaggcggtgcccca
ggaagtgggagcgatagcgagaaagactggcgcgaatcggtgacagcggacttacgcaat
catttggtacacaagctggtgcaagccatctttccgacatcggatccaactacaatgcag
gacaagcgcatgcataatttggtttcgtatgctgaaaaagtggaaaaggatatgtatgaa
atggcaaaatcgcgatccgagtactatcatctgcttgcagagaagatctataagatacaa
aaagaattagaggaaaaacgtcttaagcgcaaagagcagcaccaacaacaaatgttgcaa
atgcaacaaggtggtcccaacagtggtgtcgtcaatcctacatcagtacccaacaactcg
cttcaacaacagccgggtcagggcgtgcgtcctattatcagtccaatgggtagtggaggt
ggtggcccaagtggcatggttcaacagcagatgcgtcctcaagctcctggcatggggagc
ggcgctagccagcagcagacagcagccggacaagccaacatggtggctgtagcggcaagt
atgcgcagtcattcgcccggtggcaatatgctagccatacaacaacagcagcaacgtatg
cagttcccgcaacagcagcagcctgttcaaggcaatatgttggttggaccatccggtcca
agtcccgggggaatggtagcaaatccagtgctatctccatttaacacgcagcagaccatg
caatcagcttcgtcagttggtggtggcccaggcatattaacgagtccggtgaccgctcaa
caacaacaacaacaacaacaacaacaacaacaacaacaacaacagcagcagttcatcaat
gccaatggcagttccggtggacagaattctcaaatcagcgagataatgaaacagcgtttg
ctgcagcaacatcaacagcaaacaaacgcagccatgctattaccacagtcaccctttagc
aatgctacgcctatccagcagccgcaacagctgcaacagcaatcaaatgcatttaactca
cccatgcagcaaaaggcgcagcagccacctggtagtgtgctaaataatatgccgcccact
cccaccagcctggatgcactcactgcaggagcacctaatgctggtgctggtggcattggt
agcgggactgtgacagccccaagtccttcgcctagcttcatgtcgaacggacctattggc
acaccatcaaacaatccgccctctgtaagcagtctcatgcagccgttaagtaatcgagca
gcaacaccgccatatatacctacctcgccagtgccggctaccagcgcttcagggttggca
gccagcagtactcccgcttcggcagcagctacatgtgccaacagcggtagtagtagcaat
attagtagcaccagcagttctgtaatcacaacgacagcggttacagcggttgtcagtact
cccataagttgtgcatcaggggcaacacaaacatcaacgactgcaacaagtggcaatgta
aattcaacgccagtaagcagcacggtgctgctggtggcacgcagcaatagcgacaacact
gctacaggccgcgtgatgagcacctccagtagtttatcatctcagatggctgcactggag
gcggcggcgcgtgataacgacgatgagacaccgtcgccagctggtgctaatgatacaaat
gggagtaatggtggtggtagtagtggaggtggtggaatgtcatcaaaaggtaaactggac
tccattaagcaggaggatgagatcaaaaaggagtttatggacgatagttgcggtggcaat
ggcgatagttcacaaatggattgctcgacaggtggaaaaggcaaaaatgtaaacaatgat
ggtaccagcatgcttaaaatagaccttaagtcggaggatggagccgccggtgacgtgaag
atcaagtctgagcctatggatgtggatgaatcggcggttgtcggtggcattgctactggc
gcgaatggagatggtggcggtggaagtgatggcaaggatgatattaatggtgctattgat
ggcgtttctgcgggaattgcatcagatatcaaaattaaatctgagaccaaaccaatggtt
ccggagccactcgcaccaaatgctggcgacaagaagaaaaaatgccaatttaacccagaa
gagctgcgcactgcattactgccgacgttggataagctttatcgtcaggaaccggagtcg
gtgccatttcgttatccggtcgatccacaagctttgggaatacccgactactttgagatt
gtaaaaaaaccaatggatctaggtaccatccgcaataacatacttaatggcaaatatagt
gacccctgggagtatgtagatgatgtgtggctgatgtttgacaatgcatggctttacaac
cgcaaaacatcgcgtgtctatcgttactgcaccaagttgtcagaggtgttcgaggctgaa
attgatcctgtgatgcaagcattggggtattgttgtggtcgaaagtacacatttaatccg
caggtgctatgctgttatggcaaacagctgtgtacgataccacgagatgccaaatactac
agttaccaaaacagtctaaaggaatacggtgttgcctcaaatagatacacgttctgccaa
aagtgctttaatgacatacaaggagacactgtaactctgggcgatgatccacttcagtca
caaacccaaattaaaaaggaccaattcaaagagatgaagaacgaccatttagagctggag
cccttcgttgattgccaggagtgcggacgcaagcaacatcaaatctgtgtgctttggctt
gattcaatatggcccggcggttttgtatgtgataattgtttaaaaaagaagaactcaaaa
cgaaaggagaacaaattcaatgccaagcgattgcctaccaccaagctgggtgtgtacatt
gagacacgtgttaacaattttctaaagaaaaaggaagctggcgctggtgaggtgcacata
cgagtggtgtcttcatcggataaatgcgttgaagttaaacctggcatgcggcgtcggttt
gttgagggcggtgaaatgatgcaagagtttccatatcgggcaaaggccttatttgccttt
gaagaagtggatggcattgatgtatgcttctttggtatgcacgtacaggaatatggttca
gaatgcccagcgcctaatactcgacgcgtctatattgcttaccttgattctgtgcatttc
tttcgacctcgccaataccgcactgcggtttaccatgaaatattactcggctatatggac
tatgtgaagcagctgggctatacgatggcgcacatctgggcttgtccaccctctgaaggg
gacgactatatatttcattgtcatccgactgatcagaaaatacctaaaccgaaacgtttg
caagagtggtacaaaaagatgctcgacaaaggcatgattgaacgcatcatacaggactac
aaggatatacttaaacaggccatggaagataaacttggatcggccgctgaattgccctat
ttcgagggggatttttggccaaacgtacttgaggagagcattaaagaactggaccaggaa
gaagaggaaaaacgcaaacaagccgaggccgccgaagctgctgctgctgccaaccttttt
tccgctgaggacaacgaagtcagtggcgatggcaaaaaaaaaggacagaaaaaggccaag
aagtccaacaaatcgaaagcagcacagcgcaaaaatagtaaaaagtccaatgagcatcag
tcgggaaatgatttgtccgccaagatctatgcaaccatggagaagcacaaggaagttttc
tttgttatacgcttacactcggcccagtcagcagcaagtctggctcccatacaagatcct
gatccgttgctcacctgtgatctgatggatggacgtgatgcattcctgacacttgcccgt
gacaagcactacgaattttcttcattgcgacgcgcacagttctccacactatcaatgttg
tacgagttgcacaatcagggccaggacaagtttgtttatacttgcaacaactgcaagact
gcagtagagacgcgctaccattgtaccgtttgtgatgatttcgatctctgcacggtatgc
aaggagaaggttggacatccacataaaatggaaaaactaggcttcgatcttgacgatggc
tcggctccggctgatcttaagcaggcaaatcctcaggaggcacgcaaacagtctattcaa
cgatgcattcaatctctggtacacgcgtgtcaatgtcgggatgctaattgccgtttgcct
tcgtgtcaaaagatgaaacgggtagtccagcatacaaagaactgcaagagaaagacaaat
ggtggctgtcccatatgcaagcagctgatcgccctatgctgttatcacgctaaacactgt
caggagcaaaagtgtccagtgcccttctgtccaaacattaagctcaaactaaaacagcag
cagctacagcaaaaattgcaacagcaacaattactgcgccgccgcgtcgccctcatgtcc
agaaccgcagctcctactgctttacccggaccagcagtaagcggccctgtagttgcagcc
ggtggcgtcggtgttggtgtgccagtagtgggcatgtctggtgtggcagttagtcaacaa
gtgatgtccgggccggcttccatattgccaagtagtggcggtggcatgagtccatccaca
gtgccggtaccgtctccggtttctggtgctgtcatcgctggaatgacctcgccacatcca
caccaaccaggcattggcatgaagcccggtggtcactcgccgtcgccaaatgtcctacaa
gtggtcaaacaggtgcaggaggaagcagcacgccagcaagtgccgcatggcggtagcttt
gggaaaggcgtgccaatggctccacctgttatgcaacggcccatgggtgtaggcgtacca
aaccaaggcgcgatgggcggcatggtcggcaatcagcttactggaaatgtaggcgtggta
cccggtggtggacagatgccaagtggggggaattgcaacaatgttttgaattctaataat
ctactaccaatggatcagtggggtggaggcggtggtcctcaacaacgctatgctaacaat
acgcctaatcagcaaggaatgcgccagccaaaccaactgatgcagcaaaatatacagcaa
caacagatgttgggcataccatccaatcagctgggtgtcggtgttggagtgggtggcagc
gttgggactggtcagatgcccgtagtaggggctggcgtcagcatgggcggcggcggagca
gctcatggcataggcttaggtgcgccaattggtgctgccacctctggaggcggtgttcgc
ccaccaggcgcacaaggtgtaggcggtggtggaactggaggggcggggcccaacatggtt
aacggaccgccactcaacacgcaaacactagctcagattatgcagaagatcaaaaacaat
ccgaccaatgagagtaatcagcacatactgagtatactaaaacagaatccccaaataatg
gcggccatcataaagcagcgccagcagagccaaattaatgctgccgctggaggagctggt
ggagccggaggcgcattgcaagctggcaatggaccacaaacaccgcagcaacaacaacag
cagcagcaggtgatgcaacaacaacaaatgcagcacatgatgaatcaacagcagcaggga
cctggccctgggccacagcaaatgggacccggccaacagcagcaagtcagcctaatgcag
ggtgcacaacagccgcaacagggacctccgcatcagcgcatggccaacatgcagaataca
gctatgatgctgccaaatttgccgccgggcattaccaatcaggggggcatggtaccaaac
caaaactggactaagatgcgctatatgcaaatgaatcaatatccgccaccatatccacaa
cgccaacgcggtccacacatgggcgttgctggtcaaccgcaatttccaggcggcacaaca
ggcaactttaatgcaggaagcgctggaaatgttaccggtgtacaagtagccggtacaact
gttggaagcggtgcggctggaaccgtctctgaccaatattccatggccaatgcggcagcc
tccaatatgctgcaacagcagcagaccgtcggcggtgcaggtgttaagcctgtgccacaa
cagcaacaacaacagatgggtgtaatcccaccaggaatgcagcaacagccgatgcagcag
caacaacaacagcaaatgatgcaggctgtagcagctggtggtgggggtatgacaggtaca
aatcctcaaaatgcgttgcccggcggcagtagcggcccaactggacccggctcaaatgtg
atgggcccgccaacaccgcatacattgcagcagcaactgatgcagacggctcgctcctca
ccaccgatacgatcgccacagccaacgccttcgcccaggtctgcgccatccccacgcggt
ccgtctgcatcgccgcgcgcgcagccctcgccgcatcatgtaatgagcagtcattcaccg
gcacctcaggggccacacgatggcttgcataatcacggcatgcatcatcagtcaccgctg
ccggccgtgcctcaggatgtgggcgttagcggtgtcagtgttggggttaatgctggtaac
gtggggaatgccggcggctctctgcctgatgcctccgatcagctgagcaagtttgtggag
cggctctag

DBGET integrated database retrieval system