KEGG   Drosophila virilis: Dvir_GJ19106Help
Entry
Dvir_GJ19106      CDS       T01066                                 

Definition
GJ19106 gene product from transcript GJ19106-RA
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dvir_GJ19106
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ19106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1175 aa AA seqDB search
MENRVRNCYNKKNNSNTTTSDNSNNNNNNSQIIEKSESTRPRFPYCIYHYLERTIRAVVL
LVARVLATVYSYSISVRVSRENRRPLGQLRNRNNCSGIMVKKRQTDAQEGTSSTDSGEEE
LMNGHAGAGSAATVCQHIKKAVDTTRLRRQLKSTGLLYECQQCQKLNLPNGTGGDSTDCE
YDNTLWLCLKCGTQLCGRQRNEHALQHFKKPHSDSHALALNTRSFKIWCYECDNEVSANS
RKNLLECVELVKRLAQKPPTAVANAKTEAQQTINNIQYKIMSSMEHLSPIVPMTGGKQIS
LPVNANGGNGAIPLPPPPPPPTSIGSVPGIAKRVLDKRANYQSVAAATQASPSLGSPELD
RLPRVRGLTNLGNTCFFNAVMQCLAQTPFLLAVLKELAEPGEQFVLPGGTFNFKDKGDIE
LPMIKGTLSSWGNLTAALANALEELQSGGGVFTPSKLFDKLCAKCPQFTGGDQHDAHELL
RQLLESVRSEDLKRYQRVILQNLGYKDQDINSVSEELRQKCKIYGNQAADRILRPEQVFR
GFLVSTLTCQDCFNVSSRHEYFLDMSLPVAVEKPQPPQRRKTSPENSPASAFNSSNTKLS
NGESDVGLTSPPFYLHADGQEPLGPSKAQVKKEKERERKAKRAAKHQRTKQAQKLSLKLN
INDESNSGGGGGDGDADVDQQPGSGDGQGQVQPLSADTNGEKTRSAAWGEGPRADTLSLS
ATTSEHSDADVEDNLVEDTATGSGAKFYTDNNGNAQPLSEKRDDTPEHMDKDSLEEDEND
SGIATSPAPTTTNSAASTTSNKSNSNNNNNNNGASNVAEANNGGAVGSTVASLVNAGLSE
EGASQMRQFSSGQLQLQLQMEQLKLREQAQIVARSKRVRTQSYSDWSTTIAPRYQCEVGE
CSVPSCLNNFTAVELMTGQNKVGCESCTRRINGPDPQAKSVNTNATKQLLVSSPPAVLIL
HLKRFQLGPRCIFRKLTQQVSYSVLLDIAAFCGSKVKNLPNIDRKQKKLLYALYGVVEHS
GGLYGGHYTAYVKVRPKVTPDDKRWKFLPHGSKAELDQDDEQLKKLEELLVKEKAREMRM
NAMDDSDDFTSSSSNASTSDEASSDLNNGLADDEPTAATSGDQPAGIANGEADEAANVQP
PPGKWYYVSDSRVQEVSEKTALKAQAYLLFYERIY
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccgagtacgcaattgttataacaaaaaaaacaacagcaatacaactaccagc
gataatagcaataacaacaacaacaatagccaaatcatagagaagagcgagagcaccaga
ccaagattcccctactgcatataccactatttggagcgaacgatacgagcagtggtgctg
ctcgtcgctcgtgtcctagctacagtctactcctattcaatttcagtgcgtgtcagcaga
gagaatagacggccgctgggtcagttgaggaaccgcaacaactgcagcggcataatggtg
aagaagcgtcaaactgacgcgcaagagggcaccagctcgacagactccggcgaggaggag
ctgatgaatggacatgccggtgctggaagcgccgctacagtttgccagcacatcaagaag
gctgtcgacacgacacgcctccgccgccagctaaaatccacgggtctgctctacgagtgc
caacagtgccagaaactcaatctccccaatggcacgggtggcgattccactgactgtgaa
tacgacaacactctctggctgtgcctcaagtgcggtacacagctgtgcggccgtcagcgc
aacgagcacgcactgcagcactttaagaaaccgcactcggactcgcatgcactggcatta
aatacacgctcttttaagatctggtgctacgaatgtgacaacgaggtgtctgccaattcg
cgcaagaatctgctcgagtgcgtcgagctggtgaagcgtctggcccagaagccgcccaca
gctgtggccaatgcaaaaacagaggcgcagcaaacaattaacaacattcagtacaaaata
atgtcaagtatggagcatctgagccccattgtgcccatgactggcggcaaacagatctca
ctgccagtgaatgccaatggcggcaatggggccataccgctaccaccaccgccgccgccc
ccaaccagcattggctcagtgccgggcatagcaaagcgtgtgctggacaagcgcgcaaat
taccagtcggttgcagcggctacacaggcttctccatcgctaggcagtccagagctagat
cgcttgccacgcgtgcgtggcctcaccaatttgggcaatacttgcttctttaatgccgtc
atgcagtgtctggcgcagacaccgtttctgctagccgttctcaaggagctggccgagccc
ggagagcaatttgtgctgcccggcggcactttcaactttaaagataagggcgacattgaa
ctgcctatgataaagggcacgctttcttcgtggggcaatctcactgcggcccttgccaac
gcactggaggaacttcagtccggcggtggtgtttttacgcccagcaagctttttgacaag
ctgtgcgccaaatgtccacagtttactggcggcgatcagcacgacgcccacgagctgctg
cgtcaactgctggaaagcgtacgctccgaggatttgaagcgctaccaacgtgtcatcttg
cagaatctaggatataaggatcaggatattaacagcgtgtctgaggaactgcgccagaag
tgcaagatctatgggaatcaggcagctgatcgcatactgcgcccggaacaagtgtttcgc
ggttttcttgtctcgacgctgacctgtcaggattgttttaacgtctcttcgcgtcacgag
tactttctggacatgtcgctgcccgtggcagtcgaaaagccgcagccaccacagcgccgc
aaaactagtcccgagaactcgcctgcctccgctttcaacagtagtaacaccaagctcagc
aacggcgagtcggatgtgggcttgacatcgcctccgttctatctacacgctgacgggcag
gaaccgttggggccctccaaggcacaggtgaagaaggagaaggagcgcgagcgcaaggcc
aaaagggctgccaaacaccagcgcaccaaacaagcccaaaagctttccctcaagctgaac
attaacgatgagtctaacagcggcggtggcggtggtgatggtgacgccgatgttgatcag
cagcccggtagtggcgatgggcaggggcaagtacagccactgtctgccgataccaacggc
gagaaaacacgctccgcggcctggggtgaaggtccgcgcgcagatacactatccttaagc
gcaacaacatccgagcattcggatgctgatgtagaggacaatctggttgaagacacggca
acgggcagcggggccaagttctatacggacaacaatggcaacgcgcagccgctgagcgag
aaacgcgatgatacgcccgaacacatggacaaggattcgctggaggaggacgagaatgac
tcaggcatagccacaagtccggcacccaccaccaccaacagcgctgccagcaccaccagc
aacaaaagcaatagcaacaacaataataataataatggagccagcaatgtagcggaagcg
aacaatggcggagcggttggcagcacagttgccagtttagtgaatgccgggctgagcgag
gagggtgcctcgcagatgcgccaattctcttcggggcagctgcagctgcagctgcagatg
gaacagctaaaactgcgcgagcaggcccagattgtggcccgctcaaaacgtgtgcgtacg
caaagctattcggactggagcaccacgattgcgccgcgttatcagtgcgaggtgggagaa
tgctcggttccgtcgtgtctcaataactttaccgccgtcgagctaatgactggtcagaac
aaggtcggctgcgagagttgcacgcgccgcatcaacggccccgacccgcaggctaaatct
gtgaacacgaatgcgacaaagcagcttctagtatccagtccgccggcagtgctcattttg
catctaaagagattccagctgggcccgcgctgcatctttcgtaagttaacgcagcaggtc
agctactcggtgctgctggacatagccgccttctgcggatccaaggtaaagaacttgccc
aacattgatcgcaaacagaagaagctgctctatgcgctctatggcgtagtcgagcactcg
ggcggcttatatggcggacactacaccgcctatgtaaaggtacgtccgaaggtgacacct
gatgacaagcgctggaaattcctgccgcatggcagcaaggccgaactagatcaggacgat
gagcagctgaaaaagcttgaagagctgctggtcaaggagaaggcccgtgagatgcgcatg
aatgccatggatgacagcgatgactttaccagctccagcagcaatgcgtccacctcagac
gaggcctcctccgatctaaacaatggccttgccgatgacgaaccaactgctgctacctct
ggcgatcagccggctggcatcgccaacggcgaagcagatgaggcggccaatgtgcagcca
ccacccggcaaatggtattacgtgtcagattcacgtgtccaggaggttagcgagaagacg
gccctcaaggcacaggcatatctgctgttctacgagcgcatctattag

DBGET integrated database retrieval system