KEGG   Drosophila virilis: Dvir_GJ19139Help
Entry
Dvir_GJ19139      CDS       T01066                                 

Definition
(RefSeq) GJ19139 gene product from transcript GJ19139-RB
  KO
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
dvi  Drosophila virilis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dvir_GJ19139
Enzymes [BR:dvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dvir_GJ19139
Transcription factors [BR:dvi03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    Dvir_GJ19139
Chromosome [BR:dvi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dvir_GJ19139
   HMT complexes
    MLL3/MLL4 complex
     Dvir_GJ19139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1142 aa AA seqDB search
MPPGTLSAGAAVPLVNMSGNTQLSGPLATGSHSLAGSGGAGGMGSPMLKKRVRKFSKVEE
DHDAFTEKLMTHIRQMQPLQVLEPLLNRNFLIGSGPCFGSNGSNANGGGGGGGKLKAISR
ALQLQRQLDDGEGGSSGSIDCDQLLGRIGQLRHPSIKSLYDSERFGGSGDTTANNLASNG
NNIQSSSGSLSSIQNDFYDQEFSTHIQRNPRERLQRLISAVRDCNLETTELVELQQQQQQ
QQQQATGMRLDGPVSWSRLSRYPGLVLLNTNSNQRCAPGRMSPVALAMDANTMRPPISPL
LRSCGEELRKAQQLDLGIGLGNNNNNNYQQKNQNVILSLHSSATDNIAGVLRDLANLLHL
TPALTCKLIDASTADKAKEPSEAELGPGQSNSATAPATATATAVTSHGNLRKILTGQRKL
CRCCGSVIAAFGLRVPHQNLPEEQPPPMLAMLRSLLPRKSPPLPYIYFCNRSCFAQYKWR
GKEEPADEEVAAAAAAASATTLPIAGDVPASSTMAMLPIDKVEPDDLEMEQQQQQHQQLQ
QQQQQQQEQQQQQQQQEQQQQQQVEQTPTTPPVKRKCIVKYYSADCFAAHNTEGASIKQE
NETTTANNTVWETDCKMEALEDSRQCVFCNQRGDGQADGPSRLLNFDVDKWVHLNCALWS
NDVYETVSGALMNFQMALQSGLNQACSACHQLGATIKCFKSRCSNLYHLPCAIKEECIFY
KNKSVHCSAHAASSSAGVTENELSSFVVHRRVFVDRDENRQVATVMHYSELSNLLRVGNM
TFLNVGQLLPHQLEAFHTPNYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEVGCRPEFRI
QVHDASDKEPDREYRDSTPTAVWQQILQPIQRMRKVHKWLQLFPQHISGEDLFGLTEPAI
VRILESLPGIETLTDYRFKYGRNPLLEFPLAINPSGAARTEPKQRQLLVWRKPHTQRTAG
SCSTQRMANSAAIAGEVACPYSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAAR
DIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRLDEDRVVDATLSGGLARYINH
SCNPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSYDYKFDIEDDAHKIPCACGAPNCRKW
MN
NT seq 3429 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaggcacattgtccgccggcgctgcggtcccgttggtcaacatgtctgggaac
acgcagctaagcggtccgctggccacaggcagccattcgctggcgggcagcggtggcgcc
ggtggcatgggctcgcccatgctgaagaagcgtgtgcgcaagttctccaaggtcgaggag
gatcacgatgcatttaccgagaagctaatgacgcacatacgccaaatgcagccgctacag
gtgctcgagccgttgctcaatcgcaattttctcattggcagtggcccatgctttggcagc
aatggcagcaatgccaacggcggcggcggcggcggcggcaaactgaaggccatatcgcgt
gctctacagctgcagcgacagctggacgatggcgagggcggcagcagcggcagcattgac
tgcgatcagctgctcggccgcattgggcagctgcgtcatcccagcatcaagtcgttgtac
gatagcgaacgcttcggcggcagcggcgacaccaccgccaataatcttgccagcaacggc
aacaacatccagtctagcagtggctcactctcgagcatacagaatgacttttacgatcag
gagttctccacgcacatccagcgcaatccgcgcgagcgtctgcagcgcctgataagcgcc
gtgcgcgactgcaacttggagaccacagagctggtcgagctgcagcagcagcagcaacag
cagcagcagcaggcaactggcatgcgtttggatgggcccgtttcctggtcgcggctgagt
cgttatccgggcctggtgctgcttaataccaacagcaatcagcgctgtgcaccgggacgc
atgtctcccgtggcgctggccatggatgcgaatacgatgcgtccgcctatctcgcccctt
ttgcgcagctgtggcgaggagttgcgcaaggcgcagcagctcgatctgggcattggcttg
ggcaacaacaacaacaacaattatcagcagaagaaccaaaatgtgatactctcgctgcac
agttcggcaacagacaacattgccggcgtgctgcgagatttggcgaatctgttgcacctg
acacccgcgctaacctgcaaactgatcgatgcctcaacggcggacaaggccaaggagcca
agcgaagcagagctgggtcctggccagagcaactcggcaacggcaccggcaacggcaaca
gcaacagctgtcactagtcacggcaacctgcgcaaaatactcaccggacagcggaagctg
tgccgttgctgtggcagcgtcattgccgctttcggcctgcgcgtgccccatcagaatttg
ccggaggagcagccaccgcccatgctggcaatgctgcgttcgctgctgccgcgcaaatcc
ccgccgctcccgtatatatacttttgcaatcgcagctgctttgcacagtacaaatggcgc
ggcaaggaggagcccgccgacgaggaggtggcagcggcggcagcggcggcctcggccaca
actttgccaatagctggcgatgtgcctgcgagcagcaccatggccatgctgcccattgat
aaggttgagcccgacgatcttgaaatggagcaacagcaacagcaacatcaacagttgcag
cagcagcagcagcaacaacaagaacaacagcagcaacaacaacaacaagagcaacaacaa
cagcagcaggtcgaacagacgccaacaacgccacctgtgaagcgcaagtgcatcgtcaag
tactacagcgccgattgctttgcagcacacaacacagaaggtgcgtccatcaagcaggag
aatgaaacaacaacagccaataataccgtctgggagacagactgcaagatggaagccttg
gaggatagccgtcaatgcgtcttctgcaatcagcgcggcgatggccaagccgatggaccc
tcacgtctgcttaattttgatgtggacaaatgggttcatctgaattgtgccttgtggtcg
aacgatgtctacgagacggtgtcgggtgcgctgatgaatttccagatggccctgcagtcc
ggactgaatcaggcatgcagcgcctgccatcagctgggcgccaccatcaagtgcttcaag
tcgcgctgcagcaatctctaccatctgccctgcgccatcaaggaggaatgcatcttctac
aagaacaaatcggtgcattgcagcgcacatgcggccagcagttcggcgggtgtcaccgaa
aatgagctcagctcgtttgtggtccatcgacgggtgtttgtcgatcgcgatgagaaccgt
caggtggccacggtcatgcactattcggagctgagcaacttgctgcgcgtgggcaatatg
acatttctcaatgtgggccaattgctgccgcatcagctggaggctttccacacgcccaac
tacatttaccccattggctacaaggtgagccgctactattggtgcgtgcgccgaccgaat
cggcgatgtcgctatatctgcagcattgccgaggtcggctgccggccggagttccgtata
caggtgcacgatgccagtgacaaggaaccggatcgtgaataccgcgacagtacaccgacg
gccgtttggcaacagatcctgcagcccatacagcgtatgcgcaaggtgcacaaatggctg
cagctctttccacagcacattagcggcgaggatttgtttggtttaacggagccggctatt
gtacggatattggagagtttgccgggcattgagacgctcaccgattatcgtttcaaatat
ggacgcaatccattgctggagttcccgctggccatcaatccgtccggtgcggcacgcacc
gagcccaaacagcgtcagctgcttgtctggcggaaaccgcacacacagcgcaccgccggc
agctgcagcacccagcgcatggccaattcggcggcaattgccggtgaggtggcgtgtccg
tatagcaaacagtttgtccactccaagagttcgcagtacaaaaagatgaaacaggaatgg
cgcaacaatgtctacttggcgcgatcaaagattcagggcctcggcttgtacgcagcacgc
gacatcgagaagcatacgatgatcattgagtatattggcgaggtaatacgcacggaagta
tcggagatacgtgagaaacaatacgaatcaaagaaccgtggtatctatatgttccgcttg
gatgaggatcgcgttgtcgatgcaacactgagcggcggtctggcgcgctatatcaatcac
tcctgcaatccaaactgtgtcacagagatcgttgaagttgatcgcgatgtgcgcatcata
atatttgccaagcgtaaaatctatcgaggcgaagagctctcgtacgactataagtttgat
attgaggatgatgcgcacaagataccctgcgcttgtggtgcgcccaattgtcgaaagtgg
atgaattag

DBGET integrated database retrieval system