KEGG   Drosophila virilis: Dvir_GJ19166Help
Entry
Dvir_GJ19166      CDS       T01066                                 

Definition
GJ19166 gene product from transcript GJ19166-RA
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dvir_GJ19166
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ19166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 938 aa AA seqDB search
MIVAISSTSAAGSGSLYGTTSTSGAGSSTSTGSSSSSSGSSTTTSGIGIGGGGGTSNGYS
RYSSSYYDNRGSSLSKLLPSSAGTGSSTAGTSSTSAYNHHSSSASSYYPSSYSAYSYTPR
INTQRNSIGSASYLSGGSGSALNSGYRNSASYLSGSNYDSVSYGRCGLPRRGKGTTSNGD
VSTTSSTGTTTTTTSTGTATKKDDWGLKQRRDAAKKLPPSGADGNGNDATANGSSSKRLS
SSCSSSSLAHFVATSALDIYEKYSPANYKPNCELSRSRSAVNEADTDNRNNNSNSNNSND
NSATCTVTLDRPRSSSRYSRLYSSNSDAGGADTSASETSHLRQRSGSGRYTISGSNSSGD
VPTATFTLRSNRTRRNAAQDVAAKSITNGHAAALEANSNGLDAKLNGLSLLSTSPKRNAI
YESSSVTAADTTDDATATVNSLTVTAGKGKANGDVNGAADGDVDADGDVSATATLTLAEG
AAARSKRHHHHQHNNDAGGAAAAAAVAVSASAQGAYSSSSSSTSSSAAAAAAAATVNSVT
ASDSVSRNSGGTVRSVLPPVSPTSSRYWDRDSGRNNTNATSSSIGTSSLSNKHNNLDDGY
KSTRDEKFEGLCGLRNIGNTCFMNSVIQCLSHTTELTRFLRAHHTSTRTATSKDQQILHE
FAKLIQEMWTTNVHSVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNTGVK
GETLNIDDNLSDNKKADLTWEWYARHENSLIRDLFVGQLKSTLKCTTCGNTSVTFDPFWD
LSVPLPSSSRCKLEACLDLFIREEVLDGDEMPTCSKCKTRRKCTKSFTIQRFPKYLVIHL
KRFSETRWSKLSNIVEFPTADRELNMASYGANANSNVHYSLYAISNHMGSTAGGHYVALC
KHPVSHKWHEFNDNSVSDAIPENCLVSSSAYILFYERA
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgatagtggccatatcgtcaacgtcagcagcgggcagtggcagtctctacggcacaacg
tcgaccagcggcgctggcagctcgaccagcaccggtagcagcagcagcagcagcggcagc
agcaccaccaccagcggcatcggcatcggcggcggcggtggcacaagcaacggttattcg
cgctattcgagcagctattacgataatcgcggcagcagcctatcgaaattgctgccctca
tcagctggcacgggcagctccacagccggcacatcgtccacatccgcctacaatcatcac
agcagcagcgcgagcagctactatcccagctcctattcagcgtattcgtatacgccgcgc
atcaatacacagcggaatagcatcggatctgcatcgtatctgagcggcggttccggatct
gcactcaattctggatatcgaaatagtgcatcgtatttgagcggctccaattatgattca
gtttcatacggccgatgcggattgccgcgtcgaggaaagggcacaacatcgaatggcgac
gtgtcaacaacaagctcgacaggcacaacaacaacaacaacatcaacaggcacagcaacc
aaaaaagacgattggggcttaaaacaacgccgagatgctgccaaaaagctgccaccgagc
ggtgcagatggcaatggcaacgatgcaacagctaacggcagcagctcaaaacgtttgtcc
agctcatgctcatcatcatccctagcacattttgttgccacatctgccctggacatatac
gaaaagtacagtccggccaactataaacccaactgtgaactgtcacgttccagatcggcg
gtcaatgaagccgacactgacaaccgcaacaacaacagcaacagcaacaacagcaacgat
aacagcgccacctgcaccgttacactggacagaccgcgcagcagcagccgctacagtcgc
ctatatagcagcaacagcgatgccggcggcgcggatacatcggccagcgaaacatcacat
ctacggcagcgcagcggttcaggcagatacacaataagcggcagcaacagcagcggcgat
gtgccaacggcgacttttacgctgcgcagcaatcgtacgcgacgcaacgctgcacaggat
gtggcagcgaagagcattaccaatggccatgcggctgcgctggaggcgaacagcaatggg
ctggacgccaagctcaatggactatcgctgctgtcgacatcgcccaaacgcaatgccatc
tacgagagctccagcgtgacggcagcggacaccacagacgatgcgacggcgacagttaat
agcctaacggtgacagctggcaagggcaaggccaatggtgatgtcaatggcgcagctgat
ggcgacgtcgatgctgatggtgatgtcagcgccacagcaacgctgacgctggcagagggc
gccgctgcgcgcagcaagcggcatcatcatcatcagcacaacaacgatgcgggcggagca
gcagcggcagcagcagttgctgtctctgccagcgcccagggcgcctactcttcctcctcc
tcctccacctcctcctctgccgccgccgccgccgccgccgccacagtcaacagcgtcaca
gccagcgacagcgtatcacggaatagcggaggcaccgttcgttcagtgctaccacctgtc
tcgccaacatccagccgctattgggatcgggacagcggacggaacaacaccaacgccaca
tcctcttccattggcacatcatcgttgagcaataagcataataatctcgatgatggctac
aaaagcacccgtgacgagaagttcgagggtctatgcggtctgagaaacattggaaacact
tgcttcatgaactcggtcatccaatgcctgagtcacacgactgagctgacgcgctttctg
cgcgcacatcataccagcacgcgcacggcaacctccaaggatcagcaaatactacacgaa
tttgccaaactcatacaggaaatgtggacgacaaatgtgcacagcgtaacgccgatggaa
ctgaagcgcgccttttcgacaaagcatcgcatgtacagtgattacaatcaacaggatgcg
caggagtttctgcgcttctttcttgactcgctgcactcggcgctcaacaccggcgtcaaa
ggtgaaacgcttaacattgatgataatctcagtgacaataagaaggccgatctgacttgg
gagtggtatgctaggcatgagaattccctgatacgtgatctgtttgttggtcaattgaag
agcacactaaagtgcacaacgtgtggaaatacaagcgttacctttgacccattctgggac
ttgagcgtgccactaccatcgtcatcgcgctgcaaactagaggcctgcttagatctgttc
atacgcgaagaggtgctagacggtgacgagatgcccacatgctccaaatgcaagacacgc
cgaaaatgtaccaaaagctttaccatacagcgtttccccaaatatctggtgatacatctc
aaacgcttctctgaaacgcgctggagcaagctctcgaatattgttgagttccccacagcg
gatcgtgagctcaatatggcctcatatggcgccaacgcaaattcgaatgtgcattattcg
ctctatgcgatctccaatcatatgggctcaacggctggtggtcattatgtggcactctgt
aagcatccggtctcacacaagtggcatgagttcaatgataatagtgtcagcgatgctata
cctgaaaactgtctcgtttcatccagtgcctatattttattctacgaacgagcgtaa

DBGET integrated database retrieval system