KEGG   Drosophila virilis: Dvir_GJ19315Help
Entry
Dvir_GJ19315      CDS       T01066                                 

Definition
(RefSeq) GJ19315 gene product from transcript GJ19315-RB
  KO
K19603  
mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dvir_GJ19315
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dvir_GJ19315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1073 aa AA seqDB search
MRVRKSEPLHHRPLIKEKHKERNKDKDKDKEKLMAERQSNAQERRIHELDQNVERYFEVR
KRLGKGAYGIVWKATDKRQKDTVALKKIYDAFRDETDAQRTYREVVFLRAFRHHPNIIRM
LDIFKAANNLDFYLVFEFMDSDLHNVIKKGDVLKDIHKRFVMYQLINAIKYMHSGNVIHR
DLKPSNILIDSKCRLKVADFGLARTLCSKRRNNVDFDCKDELDNEAMLTDYVATRWYRAP
EILVASRKYTKGIDMWSLGCILGEMIRQKPLFQGTSTINQIEKIVNALPDVTERDIESIG
ASFGSVLLSKKIVRDRRHSLDEMLRNCCDDAMSLVKSLLVLDPDGRLTAKEAIAHSYVHR
FRTASANMELRTDIKPPLDDDVRYGVDEYRSTLYEMIAPDMRSSARHSSTTQTTPTNGPE
LQPGITTRVIRSVSKSRAPAGHFHAAGTGHVEQLPEKPITSLTKAWAEEQRKQRHLEQQQ
HFPQRYHQQQAQQLRRTEPTHVALRRELAAVAATAPRCVSGGLWQAPIGPAAAPTVAPPA
AAAAGPAAAQPPLRLWTEPVPVPGPLPMHVPPPAEPESMGTTAQLRARVRKLRKECKERR
LIKIKEAELARRDAKIELEPSTEEELSETISQQYSQMRDQTMSNMHAADMVKSHAEQLAQ
SHAQELADLQLRKYAQAHVKTMERVVPKTMQLAQAQAQAQAQAQPQSQSPAQAQTLEQQL
RKDHKPIDLTSALERLKLEHQELQQKKYNISEADALNQRAQQQLIQKHQMRKIAQEASES
ALRLLKQQRQMQMHPDDEGDRFYTPEGTTRQADSLSQVSAPLEPGELGDKLEGNIKASNA
SAAFVCYKTRLSRLEEEMAKCKRQLFHYVQDNQQLLTKQSLRQHIERLLQSSPIQPPQPP
PPPPPPPPPASTTSKSEAGLDVPKLDRDKQKQLQMREFLARDETNANAYELPDLCNVYKT
SSCHAQPMGTPDARRPLSPSMLDTADIDNMHGCDVNQKSGQQATHFYSNYFPEPVKNQAF
EHAWNKREHTHGHNAKRHHQSAAPSCDRLRIQEANFYDNFEPMKNDEPHATRK
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgagggtccggaagagcgagccacttcatcatcggcccttgatcaaggagaagcacaag
gagaggaacaaggacaaagataaagacaaggagaagctaatggccgagcgacaatcgaat
gcccaggagcgacgcattcatgagctagaccagaatgtggagcgttacttcgaagtgcgc
aagcgcctgggcaagggcgcctacggcatcgtgtggaaggccaccgacaagcggcaaaag
gacaccgtggccctcaagaagatctacgacgccttccgggatgaaaccgatgcccagcgc
acatatcgcgaggttgtcttcctgcgcgcctttcgccaccatcccaatattatacgcatg
ctggacatattcaaggctgctaacaatttggacttttatttggtgttcgagttcatggac
agcgatctgcacaatgttatcaagaagggggacgtcctcaaggatatacacaagcgcttt
gtcatgtaccagctgatcaatgcgatcaagtacatgcactccggaaatgtcatacacagg
gatctcaagccgagcaacattctcattgacagcaaatgcagactcaaggtggccgacttt
ggactggcgcgcactctgtgctcgaagcggcgcaacaatgtggactttgactgcaaggat
gagctggacaacgaggccatgctgacggattatgtggctacccgctggtatcgggcgccc
gaaattctggtggccagtcgcaaatatacaaagggcattgatatgtggagcctgggctgc
attctcggcgagatgatacgccagaagccgctcttccagggcaccagcacaataaatcag
attgagaagatcgtgaatgcgctgccggatgtgacggagcgggacatcgaatcgattgga
gccagcttcggctcggtgctgctcagcaagaagattgtgcgggatcgccgccactcgctg
gacgagatgctgcgcaactgttgcgacgatgccatgtctctggtcaagtcgctgttggtc
ctggatccggatggccggctgaccgccaaggaggccatcgcccactcgtatgtgcatcgc
tttcgcactgcctccgcaaacatggagctgcgcacggacatcaagccgccgctcgacgac
gatgtacgctacggcgtggacgagtaccgttccacgctctacgagatgattgcgcccgac
atgcgatccagtgcacggcactcgagcaccacacagacgaccccaacaaatggccccgaa
ctgcagccgggcatcaccacgcgcgtcatcagatccgtatcgaagtccagagcacccgct
ggccatttccatgcagctggcactgggcatgtggagcagctgcccgagaagccgatcacc
tcgctgaccaaggcctgggcggaggagcaacgaaagcagcgacacttggagcagcagcaa
cactttccacagcgctaccaccagcagcaggcgcaacagctgcgtcgcacggaaccgacg
catgtggcactgcgccgggaactggccgctgtggctgcaacggcaccgcgctgcgtcagc
ggtggcctgtggcaggcgccaattgggccagcggctgcaccaaccgtcgcaccgccagct
gcagcggcagccgggccggcggcagcgcagccaccgctgcgcttatggacggaacctgtg
ccggtgcccggacccttgcccatgcacgtgccaccaccggcggaaccggagtcaatgggc
accacggcacagctgcgcgcgcgggttcgcaagctgcgcaaggagtgcaaggagcggcgt
ctgatcaagatcaaggaggcagagttggccaggagggatgccaaaatagagctcgagccg
tcgaccgaggaagagctctctgaaacaataagccaacaatattcgcaaatgcgcgaccag
accatgtccaatatgcatgcggcagacatggttaaatcgcatgccgaacaactggcccag
tcccatgctcaagagttggccgatctgcaattgaggaagtacgcccaggcgcacgtcaaa
actatggaacgggtggtgcccaaaacaatgcagttggcccaggcgcaggctcaagcacag
gcccaggctcagcctcaatcgcagagcccggctcaggcccagactttggagcagcaattg
cgcaaggatcataagcccatcgacctgacatccgccttggagcgactgaagctagagcat
caggagctgcagcagaagaagtacaatatcagcgaagccgatgcactgaatcaacgtgcc
caacagcagctaatccaaaagcatcaaatgcgtaaaatagcccaggaagcatccgagagc
gcactgcgtctgctcaagcagcagcggcaaatgcaaatgcatccggatgatgagggcgac
cgcttctatacgcccgagggcacaacgcgacaggcggattcgttgtcgcaggtgtcggcg
ccattggagccgggcgagctcggcgacaagttggagggcaatattaaagcgtcaaatgct
tcggccgcgttcgtttgctataagacgcgcctgagccgcctggaggaggagatggccaag
tgcaagcgacagctgttccactatgtgcaggacaatcagcagctgctcaccaagcagagt
ctgcgccagcatatcgagcggttgctgcagtcctcgccgatccagccgccgcagccaccg
ccacccccaccaccgccgccgccgccggcatcgacgacgagcaagagcgaagctggcttg
gatgtgcctaaactggaccgggacaagcagaagcagctgcaaatgcgcgagtttctggca
cgcgacgagaccaacgcgaatgcctacgagctgcccgatctgtgcaacgtgtacaagacc
agcagctgccatgcccagccaatgggcacaccagatgcacgtcgtccattgtcaccctcg
atgctggacacagccgacatcgacaatatgcatggctgcgatgttaaccagaaaagtggc
caacaggcaacgcacttctattccaattactttccggagccagtcaagaatcaggcgttc
gagcatgcctggaacaagcgggagcacactcatggacataacgccaagcggcatcatcag
tcagcggcgcccagctgcgatcgcctgcgcatccaggaggccaatttctatgacaacttt
gagccgatgaaaaacgatgagccgcatgcaactcgcaagtaa

DBGET integrated database retrieval system