KEGG   Drosophila virilis: Dvir_GJ19412Help
Entry
Dvir_GJ19412      CDS       T01066                                 

Definition
(RefSeq) GJ19412 gene product from transcript GJ19412-RB
  KO
K06091  
MAGUK p55 subfamily member 5
Organism
dvi  Drosophila virilis
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dvir_GJ19412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1977 aa AA seqDB search
MQANSSRSTLSAQSSGTPSASTISSSQGKQQVVELSGYVIILVENAEGKIKLYGSPSDRD
NLEVGDEILEVNGLTLDNISRTEAIRHIHDCIKSCTICLRVRKKNDSRLAWDIGNSVQDA
FVIAVEEHARERLQRLAALNRVTPVDITQLSKKLQQTKSGTVTSQKQDLSFLNDSTPIYV
TSFSSNQITCSSATMTTATAGGPISAPSLVPTTATATILQHLAEEVDDDDMDDDDDVDGA
NYCGITYISYNNKHAQLPTTTLPATTTLPAAAATLATTAAIHQQRQSLTQLQSRPLPLQL
SSDAVTGAAAVAAGVAGAGVAGAGAGAGAGVGGAHFVDAQTSTSPLAATAAAATTAAAAA
GAAAAAAGAAAGGGGATTIVTVADIALPMHGHGHAHGTTTPKTEYSTAISSGQLQQAFAD
LQQHGHGSNIAGHLQQHQHQQQQHLLLSNNNNSNNCITSGNINININNSSSSSSNIISNI
GTSAMKNCDLLISNNLYPPRRELLTTLNDDVIVHQSDDCLGLPYNTTATAPPIAGTSSNS
SQQQLLSTAGAFDLQQQQLQQQQQQQQQQQQQQLQQQHSPTSSISKGRTELLLGDQLLRQ
ESRPRRRSGSSIVVIDGDDLKPCLPDDYISGQHHHLHHHQQQQQQQQQQQQQHYRTHSSD
IREIDQEMLTMLSMNQDNGPHREMAVDCPDTFIARNKTPPRYPPPRPPQKHNTNHTTITS
ITNNTNTINNTITKNTTKTKNDHANKLLIVAYHSSHQHEQQQHHHQLQQQQQQQQLHSSK
TTTTTTTIALDVATQNLYNQKQQTKLEQIENYENDLQTDQQQQSQQLAATAATAAAATTA
TGVQTAQQQMPSYKLQAAFGSNNPDVSNSNNHTSNGNSNTNSNSNSVADELLCVVDGIYC
KGASSPSSSTFDDMLSKQTLESFETIAYRHLQHRQQQHQQQQQQQQQQTASNCNGNSNSS
NSSNNNSNNNNSSNSNSTAATPNKLTGISSSSNSNSNSLNSTRSSSNSSMHTSSNSHSSS
SVSSSSHSSHIASAPSTTSSSTVPDDLSLAPPGYEPSSQQQLPPAGMSLLLPATATASAP
PAKHRELPVDVPDSFIEMVKAPPRYPPPAHLSSRGSLLSNGSSSNATTFSSLGVATASAA
AGCASAAVPVAGDAQRIADELNGNAKPLPPPRDHLRTEKDGRLINCAPAPQLPDRRMPGN
GSGAATQQQQQQQQQIAQIVAPTLEQLDSIRKYQEQLRRRREEEERIAQQNEFLRNSLRG
SRKLKALQDTATATPTAGKALAQQQQATTAATAATIAGVENEAYLPDEDVTPTEHIDGYG
ELIAALTRLQGQLAKSGLSTLAGRVSAAHNVLASASVAHVLAARSAVLQRRRPRVAGPLH
VNALGLQKEIVELLTQSNTAAAIELGNLLTSHEMEGLLLAHDRIASHTDATPSPTGTMPT
PSHTPTVTTTTLSGHSSPVPAAKVSASSRSMAVLPPVVPASSVAQRGAMPLPVAVAVRGE
SPPGMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGLLH
EGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPPGGGLCSGLGMHHVVGG
MAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEED
QTLAGLIPSQSFQHQRETMKLAIAEEAGLARSRGKEGASSKGATLLCARKGRKKKKKASS
EAGYPLYATTAPDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMADS
ERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIR
TVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDI
IATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWVHNNRDES
NT seq 5934 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaacagcagccgatccacgttaagcgcacaatcctcgggcactccgtcggcc
tccaccatatcctcgtcgcagggcaagcaacaagttgtcgaactatctggttatgttatc
attctcgttgagaatgcggagggtaaaattaaattatacggctcaccgtccgatcgcgat
aatctggaagtgggcgatgagatactcgaggtcaatggactcaccctggacaatatatcg
cgcactgaggccatacgacacatacacgattgcattaaatcctgcacaatttgtttgcgt
gtgcgcaagaaaaatgattcgagattggcgtgggatattggcaactccgtgcaggacgcg
tttgtcatcgccgtggaggagcacgcgcgggaacgtctgcagcgcttggcggccctgaat
cgcgttacgcccgtggatataacacagctttccaaaaagctgcagcaaacgaaaagcggc
accgtcaccagccaaaaacaggacttgagtttcctgaacgactcgacgccaatctatgtg
acgtcatttagcagcaatcaaatcacctgcagcagcgccacaatgacaacggccaccgcc
ggcgggcccattagcgccccctcgctggtgcccaccacggcgacggcgacaattttgcag
catctggccgaggaggtggacgatgacgacatggacgatgacgatgatgtcgatggtgcc
aactactgtggcatcacctatatcagctacaacaacaagcacgcccagctgccgacaaca
acgctgcccgcaacaacaacgttgcccgctgcagccgccacgctggcaacaactgcggcg
atccatcaacagcgacaatcgctgacgcagttacagtccagaccgttgccgctgcagctg
agcagcgatgctgttactggtgctgctgctgttgctgctggtgttgctggtgctggtgtt
gctggtgctggtgctggtgctggtgctggtgttggcggtgcccactttgtggatgcgcaa
acttcaacatcgccgctggcagcaacagcagcagcagcaacaacagcagcagcagcagca
ggagcagcagcagcagcagcaggagcagcagcgggaggcggcggggcaacaacgattgtg
acagtggcagatattgcattgccaatgcatggacacggacatgcgcatgggacgacaacg
ccaaaaacagagtattcgacggccatatccagcggacagctgcaacaggcgtttgcggat
ctgcagcaacacggccacggcagcaacattgctggccacttgcagcagcaccagcaccag
cagcagcagcatttacttttaagcaacaacaataatagcaataattgcatcacatcaggc
aacatcaacatcaacatcaacaacagcagcagcagcagcagcaatatcatcagcaacatt
gggacgtccgctatgaaaaattgtgatctactaatatcgaataatttgtatccaccgaga
cgagagttactaactacgcttaacgatgacgtcattgtgcatcagtccgacgattgcctc
ggcctgccatataacacaactgcaacagcaccaccaatagctggaactagcagcaacagc
agccagcaacagttgctcagcactgctggcgcctttgacctgcagcagcaacaactacaa
cagcaacaacaacaacaacaacaacaacaacaacaacagctgcaacagcaacacagtccc
acaagtagcatatcaaaaggaagaactgaactcttacttggtgatcaattgctgcgacaa
gaatcgaggccacgtcgccgttctggctccagcattgtggtcattgatggcgatgatctg
aagccatgtctgccggatgattacataagtggccagcatcatcatttgcatcatcatcag
cagcagcagcagcagcagcagcaacagcagcagcagcattatcgcacgcactcaagtgat
attagggagattgaccaggaaatgctgaccatgctgtcgatgaatcaagataacggtcca
catcgcgagatggccgtcgactgtcccgatacgtttatagcacgcaataagacgccaccc
agatatccgccaccccgtccgccgcagaaacacaacaccaaccacacaacaatcaccagc
atcaccaacaacaccaacaccatcaacaacaccatcaccaagaacacaactaaaactaaa
aatgatcatgctaacaaattgttaattgttgcatatcattcttcacatcaacatgaacaa
caacaacatcatcatcaactacaacaacaacaacaacaacaacaactacactcatcaaaa
acaacaacaactacaacaacaattgcactcgatgtggccacacaaaatttgtacaatcaa
aaacaacaaaccaaattggaacaaatcgaaaactatgaaaacgatctacaaacggatcag
caacaacaatcgcagcaactggcagcaacagcagcaacagcagcagcagcaacaacagca
acaggcgttcaaacagcgcaacaacaaatgcccagctacaagttgcaagcagcatttggc
agcaacaatccggacgtgagcaacagcaacaatcacaccagcaacggcaacagcaacacc
aacagcaacagcaacagcgtggccgacgagttgctgtgcgtggtggatgggatttattgc
aagggcgccagctcgccatcgtcgagcacttttgacgatatgctgagcaaacagacgctc
gaatcgttcgaaacaattgcctatcgtcatttgcagcatcgccagcaacaacatcagcag
cagcagcagcagcagcagcagcaaacggcaagcaattgcaacggcaacagcaatagcagc
aacagcagcaacaacaacagcaacaacaacaacagcagcaacagcaacagcacagctgca
acgcccaacaaattgacgggaattagcagcagtagcaacagcaacagcaactccctgaat
agcacacgcagcagcagcaacagctccatgcacaccagcagcaacagtcacagcagcagc
agcgtcagcagcagcagccacagcagccacatagccagcgctccatcgacaacgagcagc
tcaacagttccggatgatcttagcctggcgccgcccggctatgagccgagcagtcagcag
caactgcccccggcaggcatgtcgctgctgctgccggcaacggcaacggcatcagcacct
ccagcaaagcatcgcgagctgcccgtcgatgtgcccgatagctttattgagatggtcaag
gcgccgccacgttatccgccgcccgcacatctatcctcgcgcggctcgctgctctcgaat
ggcagctcctcaaacgcaacgaccttctcctcgctgggcgtggcaactgcgtctgctgcc
gctggctgtgcgtctgctgctgttcctgttgctggcgatgcccagcgcattgccgatgag
cttaatggcaacgccaagcccttgccgccgcctcgtgatcatctgcgtactgagaaggat
ggacgtctcattaactgcgcacccgcgccacagttgccagatcgtcgcatgcccggcaat
ggcagcggtgctgccacccaacaacaacagcagcagcagcagcaaatagcgcaaattgtg
gcgccgacattagagcagctggacagcataagaaaatatcaggagcaactgcgacgtcga
cgcgaggaggaggagcgcatcgcccagcagaatgagtttctgcgcaacagtttgcgcggc
tcacgcaaactgaaggcgctccaggacacggcaactgccacgcccacagctggcaaggcg
ctggcacagcaacagcaagcaacaacagcagccacggcagcaacaattgccggcgtggaa
aacgaggcctatctgccggatgaggatgtcacgccaacggagcacattgatggctacggt
gagctgatcgcggcgctaacacgcctccagggccaattggcgaagagcgggctaagcacg
ctagcgggccgtgtctcggcagcgcacaacgtcctggccagcgccagtgtggcgcatgtg
cttgccgccaggagcgccgtgctgcagcgcaggcgaccgcgggtggcgggaccgctgcac
gttaacgcgctgggcctgcagaaggagatcgtggagctgctgacgcagtcgaacacagcg
gcggccattgagctgggcaacctgttgaccagccacgagatggagggcctgctgctggcg
cacgatcgcattgccagccacacggatgccacgccctcgccgacgggcacaatgccgaca
ccgtcgcatacgccaacggtcacaaccaccacgctcagcggccacagcagtcccgtgccg
gcggccaaggtgtcggccagcagcagaagcatggcggtgctgccgccagtggtgccagcc
tcatcggtggcgcagcgtggcgcaatgccgctgcctgtggctgtggcggtgcgcggcgaa
tcgccgccgggcatgagcgcatgctttggcacactgaacgatcagaacgacaacatacgg
atcatacagatcgaaaagtcaacggagccgctgggagcgaccgttcgcaacgagggtgag
gccgtggtcatcgggcgcattgtgcgtggcggtgccgctgagaagtccggactgctgcac
gagggcgacgagattctggaggtgaacggccaggagctgcgcggcaaaacggtgaacgag
gtgtgcgccctgctgggtgccatgcagggcaccctcacgtttttgattgtgcctgccggc
agtccgccgccgggcggcggcctttgcagcggtctgggcatgcatcatgtggtgggcggc
atggcgcatcgggatacggccgtgctgcacgtgcgtgcccactttgattacgatccggag
gatgatctgtacataccgtgccgggagctgggtataagcttccaaaagggcgatgtgctg
catgtgatctcccgcgaggaccccaactggtggcaggcgtatcgtgagggcgaagaggat
caaacgctagccggcctcattcctagtcagtccttccagcatcagcgcgagaccatgaag
ctagctattgccgaggaagcgggtctggctcgctcccgtggcaaagagggtgccagcagc
aagggcgctacgcttctctgtgcccgcaagggtcgcaagaagaagaagaaggctagctcc
gaagcgggctatccgctgtacgcaacaacggcgccagacgaaacggatcccgaggagata
ctcacctacgaggaggtggcgctctactatccccgcgccacccacaagcgccccattgtc
ctcatcggcccgcccaacattggccgacatgagctgcgccagcgcttgatggccgactcc
gagcgtttctcggcggcagtgccacatacatcacgggccagacgcgagggtgaggtgccc
ggcgtagactatcacttcataacgcgccaggccttcgaggcggatattctggcgcgtcgc
tttgtcgagcacggcgagtatgagaaggcgtactacggaacctcacttgaggccattcgc
acagtcgttgccagtggcaagatttgtgtgctgaacctgcatccgcagagcttgaaactg
ttacgcgcctccgacctcaagccctatgtggtgctggtggcgccgccaagcctcgataag
ctgcggcagaagaagctgcgcaatggcgaaccgtttaaggaagaggaacttaaggacatc
atcgcaaccgcgcgggacatggaggcgcgctggggtcatctgttcgacatgatcatcatc
aacaatgatacggagcgcgcctaccatcaactgctggcggagatcaattcgctggagcgc
gaaccgcaatgggtgccggcccagtgggtgcacaacaatcgtgacgaatcataa

DBGET integrated database retrieval system