KEGG   Drosophila virilis: Dvir_GJ19412Help
Entry
Dvir_GJ19412      CDS       T01066                                 

Definition
GJ19412 gene product from transcript GJ19412-RA
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
dvi  Drosophila virilis
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dvir_GJ19412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1381 aa AA seqDB search
MRILKQWPRRRSGSSIVVIDGDDLKPCLPDDYISGQHHHLHHHQQQQQQQQQQQQQHYRT
HSSDIREIDQEMLTMLSMNQDNGPHREMAVDCPDTFIARNKTPPRYPPPRPPQKHNTNHT
TITSITNNTNTINNTITKNTTKTKNDHANKLLIVAYHSSHQHEQQQHHHQLQQQQQQQQL
HSSKTTTTTTTIALDVATQNLYNQKQQTKLEQIENYENDLQTDQQQQSQQLAATAATAAA
ATTATGVQTAQQQMPSYKLQAAFGSNNPDVSNSNNHTSNGNSNTNSNSNSVADELLCVVD
GIYCKGASSPSSSTFDDMLSKQTLESFETIAYRHLQHRQQQHQQQQQQQQQQTASNCNGN
SNSSNSSNNNSNNNNSSNSNSTAATPNKLTGISSSSNSNSNSLNSTRSSSNSSMHTSSNS
HSSSSVSSSSHSSHIASAPSTTSSSTVPDDLSLAPPGYEPSSQQQLPPAGMSLLLPATAT
ASAPPAKHRELPVDVPDSFIEMVKAPPRYPPPAHLSSRGSLLSNGSSSNATTFSSLGVAT
ASAAAGCASAAVPVAGDAQRIADELNGNAKPLPPPRDHLRTEKDGRLINCAPAPQLPDRR
MPGNGSGAATQQQQQQQQQIAQIVAPTLEQLDSIRKYQEQLRRRREEEERIAQQNEFLRN
SLRGSRKLKALQDTATATPTAGKALAQQQQATTAATAATIAGVENEAYLPDEDVTPTEHI
DGYGELIAALTRLQGQLAKSGLSTLAGRVSAAHNVLASASVAHVLAARSAVLQRRRPRVA
GPLHVNALGLQKEIVELLTQSNTAAAIELGNLLTSHEMEGLLLAHDRIASHTDATPSPTG
TMPTPSHTPTVTTTTLSGHSSPVPAAKVSASSRSMAVLPPVVPASSVAQRGAMPLPVAVA
VRGESPPGMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKS
GLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPPGGGLCSGLGMHH
VVGGMAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYRE
GEEDQTLAGLIPSQSFQHQRETMKLAIAEEAGLARSRGKEGASSKGATLLCARKGRKKKK
KASSEAGYPLYATTAPDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRL
MADSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSL
EAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEE
LKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWVHNNRDE
S
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctgaagcaatggccacgtcgccgttctggctccagcattgtggtcattgat
ggcgatgatctgaagccatgtctgccggatgattacataagtggccagcatcatcatttg
catcatcatcagcagcagcagcagcagcagcagcaacagcagcagcagcattatcgcacg
cactcaagtgatattagggagattgaccaggaaatgctgaccatgctgtcgatgaatcaa
gataacggtccacatcgcgagatggccgtcgactgtcccgatacgtttatagcacgcaat
aagacgccacccagatatccgccaccccgtccgccgcagaaacacaacaccaaccacaca
acaatcaccagcatcaccaacaacaccaacaccatcaacaacaccatcaccaagaacaca
actaaaactaaaaatgatcatgctaacaaattgttaattgttgcatatcattcttcacat
caacatgaacaacaacaacatcatcatcaactacaacaacaacaacaacaacaacaacta
cactcatcaaaaacaacaacaactacaacaacaattgcactcgatgtggccacacaaaat
ttgtacaatcaaaaacaacaaaccaaattggaacaaatcgaaaactatgaaaacgatcta
caaacggatcagcaacaacaatcgcagcaactggcagcaacagcagcaacagcagcagca
gcaacaacagcaacaggcgttcaaacagcgcaacaacaaatgcccagctacaagttgcaa
gcagcatttggcagcaacaatccggacgtgagcaacagcaacaatcacaccagcaacggc
aacagcaacaccaacagcaacagcaacagcgtggccgacgagttgctgtgcgtggtggat
gggatttattgcaagggcgccagctcgccatcgtcgagcacttttgacgatatgctgagc
aaacagacgctcgaatcgttcgaaacaattgcctatcgtcatttgcagcatcgccagcaa
caacatcagcagcagcagcagcagcagcagcagcaaacggcaagcaattgcaacggcaac
agcaatagcagcaacagcagcaacaacaacagcaacaacaacaacagcagcaacagcaac
agcacagctgcaacgcccaacaaattgacgggaattagcagcagtagcaacagcaacagc
aactccctgaatagcacacgcagcagcagcaacagctccatgcacaccagcagcaacagt
cacagcagcagcagcgtcagcagcagcagccacagcagccacatagccagcgctccatcg
acaacgagcagctcaacagttccggatgatcttagcctggcgccgcccggctatgagccg
agcagtcagcagcaactgcccccggcaggcatgtcgctgctgctgccggcaacggcaacg
gcatcagcacctccagcaaagcatcgcgagctgcccgtcgatgtgcccgatagctttatt
gagatggtcaaggcgccgccacgttatccgccgcccgcacatctatcctcgcgcggctcg
ctgctctcgaatggcagctcctcaaacgcaacgaccttctcctcgctgggcgtggcaact
gcgtctgctgccgctggctgtgcgtctgctgctgttcctgttgctggcgatgcccagcgc
attgccgatgagcttaatggcaacgccaagcccttgccgccgcctcgtgatcatctgcgt
actgagaaggatggacgtctcattaactgcgcacccgcgccacagttgccagatcgtcgc
atgcccggcaatggcagcggtgctgccacccaacaacaacagcagcagcagcagcaaata
gcgcaaattgtggcgccgacattagagcagctggacagcataagaaaatatcaggagcaa
ctgcgacgtcgacgcgaggaggaggagcgcatcgcccagcagaatgagtttctgcgcaac
agtttgcgcggctcacgcaaactgaaggcgctccaggacacggcaactgccacgcccaca
gctggcaaggcgctggcacagcaacagcaagcaacaacagcagccacggcagcaacaatt
gccggcgtggaaaacgaggcctatctgccggatgaggatgtcacgccaacggagcacatt
gatggctacggtgagctgatcgcggcgctaacacgcctccagggccaattggcgaagagc
gggctaagcacgctagcgggccgtgtctcggcagcgcacaacgtcctggccagcgccagt
gtggcgcatgtgcttgccgccaggagcgccgtgctgcagcgcaggcgaccgcgggtggcg
ggaccgctgcacgttaacgcgctgggcctgcagaaggagatcgtggagctgctgacgcag
tcgaacacagcggcggccattgagctgggcaacctgttgaccagccacgagatggagggc
ctgctgctggcgcacgatcgcattgccagccacacggatgccacgccctcgccgacgggc
acaatgccgacaccgtcgcatacgccaacggtcacaaccaccacgctcagcggccacagc
agtcccgtgccggcggccaaggtgtcggccagcagcagaagcatggcggtgctgccgcca
gtggtgccagcctcatcggtggcgcagcgtggcgcaatgccgctgcctgtggctgtggcg
gtgcgcggcgaatcgccgccgggcatgagcgcatgctttggcacactgaacgatcagaac
gacaacatacggatcatacagatcgaaaagtcaacggagccgctgggagcgaccgttcgc
aacgagggtgaggccgtggtcatcgggcgcattgtgcgtggcggtgccgctgagaagtcc
ggactgctgcacgagggcgacgagattctggaggtgaacggccaggagctgcgcggcaaa
acggtgaacgaggtgtgcgccctgctgggtgccatgcagggcaccctcacgtttttgatt
gtgcctgccggcagtccgccgccgggcggcggcctttgcagcggtctgggcatgcatcat
gtggtgggcggcatggcgcatcgggatacggccgtgctgcacgtgcgtgcccactttgat
tacgatccggaggatgatctgtacataccgtgccgggagctgggtataagcttccaaaag
ggcgatgtgctgcatgtgatctcccgcgaggaccccaactggtggcaggcgtatcgtgag
ggcgaagaggatcaaacgctagccggcctcattcctagtcagtccttccagcatcagcgc
gagaccatgaagctagctattgccgaggaagcgggtctggctcgctcccgtggcaaagag
ggtgccagcagcaagggcgctacgcttctctgtgcccgcaagggtcgcaagaagaagaag
aaggctagctccgaagcgggctatccgctgtacgcaacaacggcgccagacgaaacggat
cccgaggagatactcacctacgaggaggtggcgctctactatccccgcgccacccacaag
cgccccattgtcctcatcggcccgcccaacattggccgacatgagctgcgccagcgcttg
atggccgactccgagcgtttctcggcggcagtgccacatacatcacgggccagacgcgag
ggtgaggtgcccggcgtagactatcacttcataacgcgccaggccttcgaggcggatatt
ctggcgcgtcgctttgtcgagcacggcgagtatgagaaggcgtactacggaacctcactt
gaggccattcgcacagtcgttgccagtggcaagatttgtgtgctgaacctgcatccgcag
agcttgaaactgttacgcgcctccgacctcaagccctatgtggtgctggtggcgccgcca
agcctcgataagctgcggcagaagaagctgcgcaatggcgaaccgtttaaggaagaggaa
cttaaggacatcatcgcaaccgcgcgggacatggaggcgcgctggggtcatctgttcgac
atgatcatcatcaacaatgatacggagcgcgcctaccatcaactgctggcggagatcaat
tcgctggagcgcgaaccgcaatgggtgccggcccagtgggtgcacaacaatcgtgacgaa
tcataa

DBGET integrated database retrieval system