KEGG   Drosophila virilis: Dvir_GJ19430Help
Entry
Dvir_GJ19430      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 408 aa AA seqDB search
MNLPGSGSWNILQKSFRYMQETMLSNSLDRAHLNYGIVFECRTISDMDLGDEVHFHLQLG
DLSGFRRLDAKKKLALFLHGWNDQGSKDWVQELLLTWTLFDDGYNVCVVDWGNLSQNDYK
SASMSIFDVGLTVAGIIIALEEMRPRHFNRRNVTLAGYSLGAHAAGYAGAVLDGQVEQII
GLDPAGPLFTLPAAVNPKYRLDQTDAKFVQVLHTSGGTLGTSLKCGHADFYPNGGRAPQR
NCLMFMNLRDMQNTNPIACSHSAAAIFFRQSMDPQYPFIGYQCDSYREYLTGRCDNNRRA
LFGIHSHRRMHGSFFFDTTSSHPYVQRQRSNRLWNWILERSQNRNRINARHLSTDNAIGG
ELLRQRPWTRRRNRKSQRCHCERPGPGPGPGPGPGARLLPGPVEMQLA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcctgggtctgggtcttggaacatcttgcaaaagagttttcggtatatgcag
gagaccatgctaagtaacagcttagatcgcgctcatctgaactatggaattgtgtttgag
tgccgcactatctccgacatggatttgggcgacgaggtgcactttcatttacagctcggc
gacttgagcggtttccgtcgtttggatgcaaaaaagaagttggcgttgtttttgcatggc
tggaacgatcagggcagcaaggactgggttcaagaactattattgacttggaccctcttt
gatgatggttacaacgtatgcgttgtagattggggcaatctgtcacagaatgattacaaa
agcgcctcaatgtctatatttgatgttggtttgacagtggcaggcataatcattgccctg
gaggaaatgcgaccgcgtcactttaatcgccgcaacgtcaccctagcgggatacagttta
ggcgctcatgcagccggatatgcgggcgccgtgctggatggtcaagtggaacaaattatt
ggcctggatccggcggggcctctgtttactctgccggctgctgttaacccaaagtatcgg
cttgaccaaacggatgcaaagtttgtgcaagtcctgcatacctcaggcggcaccttgggc
accagtcttaagtgtgggcacgctgatttctatccgaacgggggacgagctccccaacgc
aactgtttgatgtttatgaatctgcgcgatatgcaaaacacaaatcccattgcctgcagt
cattcggcggctgccattttctttaggcaatcaatggatccgcagtaccccttcattggg
tatcaatgcgatagctatcgcgaatatctgactggccgctgcgataacaatcgccgtgct
ctttttgggattcactctcatcgacggatgcatggcagtttcttttttgacaccacctcc
agccacccctatgttcagcggcagcgctcgaatcgcctttggaattggattttggaaagg
tctcagaatcggaatcgcataaacgccaggcacttaagtaccgacaatgccataggtggc
gaactcttgcgccaacgaccgtggacgcgaaggcgtaataggaaaagccaacgttgccat
tgtgaaagacccggacccggacccggacccggacccggaccaggagccagactgttgcca
ggaccagtagaaatgcaactcgcataa

DBGET integrated database retrieval system