KEGG   Drosophila virilis: Dvir_GJ19430Help
Entry
Dvir_GJ19430      CDS       T01066                                 

Definition
(RefSeq) GJ19430 gene product from transcript GJ19430-RB
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dvi  Drosophila virilis
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dvir_GJ19430
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dvir_GJ19430
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dvir_GJ19430
  Exosomal proteins of breast milk
   Dvir_GJ19430
Glycosaminoglycan binding proteins [BR:dvi00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   Dvir_GJ19430
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dvi00537]
 Enzymes
  Dvir_GJ19430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 408 aa AA seqDB search
MNLPGSGSWNILQKSFRYMQETMLSNSLDRAHLNYGIVFECRTISDMDLGDEVHFHLQLG
DLSGFRRLDAKKKLALFLHGWNDQGSKDWVQELLLTWTLFDDGYNVCVVDWGNLSQNDYK
SASMSIFDVGLTVAGIIIALEEMRPRHFNRRNVTLAGYSLGAHAAGYAGAVLDGQVEQII
GLDPAGPLFTLPAAVNPKYRLDQTDAKFVQVLHTSGGTLGTSLKCGHADFYPNGGRAPQR
NCLMFMNLRDMQNTNPIACSHSAAAIFFRQSMDPQYPFIGYQCDSYREYLTGRCDNNRRA
LFGIHSHRRMHGSFFFDTTSSHPYVQRQRSNRLWNWILERSQNRNRINARHLSTDNAIGG
ELLRQRPWTRRRNRKSQRCHCERPGPGPGPGPGPGARLLPGPVEMQLA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcctgggtctgggtcttggaacatcttgcaaaagagttttcggtatatgcag
gagaccatgctaagtaacagcttagatcgcgctcatctgaactatggaattgtgtttgag
tgccgcactatctccgacatggatttgggcgacgaggtgcactttcatttacagctcggc
gacttgagcggtttccgtcgtttggatgcaaaaaagaagttggcgttgtttttgcatggc
tggaacgatcagggcagcaaggactgggttcaagaactattattgacttggaccctcttt
gatgatggttacaacgtatgcgttgtagattggggcaatctgtcacagaatgattacaaa
agcgcctcaatgtctatatttgatgttggtttgacagtggcaggcataatcattgccctg
gaggaaatgcgaccgcgtcactttaatcgccgcaacgtcaccctagcgggatacagttta
ggcgctcatgcagccggatatgcgggcgccgtgctggatggtcaagtggaacaaattatt
ggcctggatccggcggggcctctgtttactctgccggctgctgttaacccaaagtatcgg
cttgaccaaacggatgcaaagtttgtgcaagtcctgcatacctcaggcggcaccttgggc
accagtcttaagtgtgggcacgctgatttctatccgaacgggggacgagctccccaacgc
aactgtttgatgtttatgaatctgcgcgatatgcaaaacacaaatcccattgcctgcagt
cattcggcggctgccattttctttaggcaatcaatggatccgcagtaccccttcattggg
tatcaatgcgatagctatcgcgaatatctgactggccgctgcgataacaatcgccgtgct
ctttttgggattcactctcatcgacggatgcatggcagtttcttttttgacaccacctcc
agccacccctatgttcagcggcagcgctcgaatcgcctttggaattggattttggaaagg
tctcagaatcggaatcgcataaacgccaggcacttaagtaccgacaatgccataggtggc
gaactcttgcgccaacgaccgtggacgcgaaggcgtaataggaaaagccaacgttgccat
tgtgaaagacccggacccggacccggacccggacccggaccaggagccagactgttgcca
ggaccagtagaaatgcaactcgcataa

DBGET integrated database retrieval system