KEGG   Drosophila virilis: Dvir_GJ19488Help
Entry
Dvir_GJ19488      CDS       T01066                                 

Definition
GJ19488 gene product from transcript GJ19488-RA
Orthology
K04646  
clathrin heavy chain
Organism
dvi  Drosophila virilis
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dvir_GJ19488
   04142 Lysosome
    Dvir_GJ19488
Exosome [BR:dvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dvir_GJ19488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1427 aa AA seqDB search
MTQPLPIRFQEHLQLTNVGINPNSFSFSTLTMESDKFICVREKTNDTAQVVIIDMNDSSN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATSRSRCSENLVDLVKTSDLTLALSIYMRANVPNKVIQC
FAETGQFQKIVLYAKKVNYTPDYIFLLRSVMRSNPEQGAGFASMLVAEEEPLADINQIVD
IFMEHSMVQQCTAFLLDALKHNRPAEGALQTRLLEMNLMSAPQVADAILGNAMFTHYDRA
HIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLSVEDSLECLKAML
TANLRQNLQICVQIATKYHEQLTTKALIDLFESFKSYDGLFYFLSSIVNFSQDPEVHFKY
IQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYL
YRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQFSTDELVEEVEK
RNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERFLKENQYYDSRVVGRYCEK
RDPHLACVAYERGQCDRELIAVCNENSLFKSEARYLVGRRDAELWAEVLSEANPYKRQLI
DQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFSDHRNLQNLLILT
AIKADRTRVMDYINRLDNYDAPDIANIAISNQLYEEAFAIFKKFDVNTSAIQVLIDQVNN
LERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYMDVVDVASKVESWD
DLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQKIGDRCFSDGMY
DAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFACVDAEEFRLAQM
CGLHIVVHADELEDLINYYQNRGYFEELIALLESALGLERAHMGMFSELAILYSKFKPSK
MREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMMAHPTEAWREGHF
KDIITKVANIELYYKAIEFYLDFKPLLLNDMLLVLAPRMDHTRAVSYFSKTGYLPLVKPY
LRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDTIALAQKLEKHELTEFRRIA
AYLYKGNNRWKQSVELCKKDKLYKDAMEYAAESGKQEIAEELLGWFLERNAHDCFAACLY
QCYDLLRPDVILELAWKHKIMDFAMPYLIQVLREYTTKVDKLELNEAQREKEDDTTEHKN
IIQMEPQLMITAGPAMGIPPQYATNYPPGAAAAAAAAAGRNMGYPYM
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgttacccatacgctttcaagagcatttacagctcacaaatgtcggcatc
aatccgaactccttctcgttcagcacgctcacaatggaatcggacaaattcatttgtgtg
cgcgagaagacgaacgataccgcccaggtggtcatcattgatatgaacgactcctcgaat
ccgacgcgccgtcccatttcagcggactcggcaattatgaatccggctagcaaggtgatt
gcgctgaaagcgcaaaagacgctgcagatcttcaacattgagatgaaatcgaaaatgaag
gcgcacacgatgaacgaggatgtggtattctggaaatggatatcgctgaatacgctcgct
ctggtcaccgagacgagcgtctttcattggtcaatggagggcgattcgatgccacagaaa
atgttcgatagacattcctcgctcaatggctgtcagataatcaattaccgatgcaatgcc
tcgcagcaatggctgctccttgttggcatttcggcgctgcccagtcgtgtcgctggcgcc
atgcaattgtattccgtcgagcgtaaggtgtcgcaggccattgagggtcatgccgccagt
tttgccacctcaagatcgaggtgcagcgagaatttggtggatcttgttaagacatcggat
ctgacactagctctgtccatctatatgcgcgccaatgtgcccaacaaggtgattcaatgc
tttgccgaaacgggtcaattccaaaagatcgtgctctacgccaaaaaggttaactataca
cccgactatatattcctgttgcgttccgtgatgcgcagcaatccggaacagggcgcaggc
tttgcctccatgctggtcgctgaggaggagcccctggccgatatcaatcaaattgtcgac
atctttatggagcattcaatggtgcaacaatgcacagcctttctattggacgcactcaag
cataatcgtcccgctgagggtgcactgcagacgcgtctgcttgaaatgaatttgatgtca
gcgccgcaggtggcggatgccatactgggcaacgccatgttcacccactacgatcgcgcc
cacattgcccagctgtgcgagaaggccggcctattgcagcgcgccctggaacactatacg
gatctgtatgacatcaagcgtgccgttgttcacacacatatgctgaatgccgaatggctg
gtcagtttctttggtacactgtccgtcgaggattcgctggagtgcctgaaggccatgcta
acggctaatctgcgccagaatttgcagatttgcgtacaaattgcaacgaaatatcacgaa
cagctaacaaccaaggcgctgattgatctgttcgagagctttaagagctacgacggtctc
ttttactttttgagcagcattgtgaacttctcacaggatccagaggtgcatttcaagtat
atccaggccgcctgcaagaccaaccagatcaaggaggtggagcgcatctgtcgcgaatcc
aattgctataatccggagcgtgtcaagaacttcctaaaggaggccaaattgacagaccaa
ttgccgttgataattgtctgtgatcgtttcgatttcgtgcatgatctggtgctctatcta
taccgcaacaatctccaaaaatatattgagatctatgtgcagaaggtgaatccatcacgt
ttgccggtcgttgttggcggtcttctggatgtggactgcagtgaggatattattaagaac
ctcatactagttgtcaagggtcaattctcaacggatgagctggttgaggaggtggagaag
cgcaatcgcttaaaactgttgttgccctggctggaatcgcgcgttcacgaaggttgcgtt
gagccggccacacacaatgccttggccaagatctacattgattccaacaataatccggaa
cgtttcctcaaagagaatcaatactatgatagtcgcgtcgttggccgctattgcgagaag
cgtgatccgcacttggcctgtgtcgcctacgagcgtggtcaatgcgatcgggaactgatc
gccgtttgcaatgagaactcgctgttcaagagcgaggcacgctatctggttggacgtcgc
gatgctgaactgtgggctgaggttctatcggaggccaatccctacaagcgtcagcttatc
gatcaggtagtgcagacagctctgtccgagacacaggatccggatgatatatctgttacg
gtcaaggcgttcatgaccgccgatttgcctaacgagctgatcgaactgctcgaaaagatc
atactggactcttccgtgtttagcgatcatcgcaatctacagaatctgctcatcctgacc
gccatcaaggcggatcgcacacgcgtcatggactacatcaatcgtttggacaactacgat
gcaccggacattgccaacatagcgattagcaatcaattgtacgaagaggcgttcgccata
ttcaagaaattcgatgtgaacacctcggccattcaggtactaatcgatcaggtcaacaat
ttggagcgtgccaacgagtttgccgagcgctgcaacgagccggcagtatggtcacagctg
gccaaggctcagctgcaacagggcctggtcaaggaggcaatcgattcatacatcaaggca
gatgatcccagtgcctatatggatgtcgttgatgttgccagcaaagtggaatcctgggat
gatctggtgcgctacctgcaaatggcacgcaagaaggcacgcgaatcctacattgaaagc
gaattgatttatgcgtatgcccgcaccggacgcctggccgatcttgaggaattcatctcg
ggtcccaatcatgcggacatacaaaagattggcgatcgctgtttcagcgatggcatgtac
gatgccgccaaattgttgtacaacaatgttagcaactttgcacgtttggccattacattg
gtctatctgaaggagttccagggcgctgtcgattcggcacgcaaagccaactcgacgcgc
acctggaaggaggtctgttttgcctgtgtcgatgctgaagaatttcgtttggcgcaaatg
tgcggcctgcatattgttgtacatgccgatgagctcgaggatttgattaactattatcag
aatcgtggctatttcgaggagctaattgcgctgctggaatcggcgcttggtttggaacgc
gcacacatgggcatgttcagcgaattggcaatactctattccaagtttaagccatccaag
atgcgcgagcatctggagctgttttggtcgcgtgtcaatataccgaaggtattgcgtgcc
gccgaatcggcgcatctgtggtccgagctggtcttcctctatgacaagtatgaggaatat
gataacgctgtgttggccatgatggcccatccgacggaggcgtggcgcgagggccacttc
aaggacattatcaccaaggtggccaacattgagctctactacaaggccatcgaattctat
ttggactttaagccgctgctcctcaacgatatgctactcgtgctagcgccacgcatggat
cacacccgtgccgttagctatttctccaagacgggctacctgccgctggtgaaaccatat
ttgcgctccgtacaatcgctgaacaacaaggcaatcaacgaggcgctcaatgggctgctc
atcgatgaggaggactaccagggcttgcgcaactccatcgatggctttgacaactttgat
acgattgcgctggcgcagaagctcgagaagcacgagctcaccgaattccgtcgcattgca
gcctatctctacaagggcaacaatcgctggaagcagagcgttgagctgtgcaaaaaggac
aaactgtacaaggatgcaatggaatatgccgccgagtctggcaaacaggaaatcgctgag
gaactgttgggctggttcctggagcgcaatgcacacgattgctttgcggcatgtctatat
cagtgctacgatttgctgcgtcccgatgttatcctggaactggcatggaaacataaaatc
atggactttgccatgccctacttgatacaggtgctgcgcgagtacaccaccaaggtggat
aaactggagctgaacgaggcgcaacgcgagaaggaagacgacacaacggagcataaaaac
ataatacaaatggagccgcagctgatgataacagctggtccagcaatgggtataccgccc
caatatgccacaaattatccacctggtgcggcagcagcggctgcagcagcggcaggacgc
aacatgggctatccgtatatgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system