KEGG   Drosophila virilis: Dvir_GJ19652Help
Entry
Dvir_GJ19652      CDS       T01066                                 

Definition
GJ19652 gene product from transcript GJ19652-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dvi  Drosophila virilis
Module
cGMP signaling
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dvir_GJ19652
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dvir_GJ19652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 769 aa AA seqDB search
MVDTIDDRERDAIVSILKSEVHALKEQLREKENELIKLHREIHKLKSVLQQTTNNHVSLS
SQHQQPPEQCDVVSSSREQEHVCSACGLARPVASTELEPQALSQDSATAATTGTPTTAAG
NALQTDVAASVELRPKPLLAAIKKQGVSAESSVQSKQQSYSATIPKYDKDFSAKQQIKDA
IMDNDFLKNIDASQVRELVDSMYSKSIDAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVL
DKMGPGKAFGELAILYNCTRTASIRVVSEAARVWVLDRRVFQQIMMRTGLQRIENSVNFL
KSVPLLRNLSDQLLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPAA
LEETELRTLSRGDYFGEQALINEDKRTANIIALAPGVECLSLDRDSFKRLIGDLCELKEK
DYGDEDRMLAMKQAQAQHEEAFGAQAQQEYPDLKLTDLEVVSTLGIGGFGRVELVKAHHQ
GREDIFALKCLKKRHIVDTKQEDHIYSERSIMLSSNSPFICRLYRTFRDEKYVYMLLEAC
MGGEIWTMLRDHGSFEDNAAQFIIGCVLQAFEYLHARGILYRDLKPENLMLDERGYVKLV
DFGFAKYIGNSAKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGAPPFTAP
DPMQTYNLILRGIDMITFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLG
FDWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDPSEPPDELSGWDADF
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatacaatcgatgatcgggaacgagatgcgatcgtcagcattctgaaaagtgag
gtgcacgcgctgaaggagcagctgcgcgaaaaggagaacgagctgatcaaattgcatcgg
gaaatacacaagttgaagagtgtgctgcagcaaaccaccaacaatcatgtgagcttgtcc
agccagcatcaacagccaccggaacagtgtgacgtggtcagcagcagtcgagagcaggag
catgtatgcagcgcctgcggtctggcgagaccggtcgccagcacagagctcgaaccgcag
gcgctaagccaggactcagcaacagcagcaacaacaggaacaccaacaacagcagcggga
aatgcattacaaacggatgtggcggcgtctgtggagctgcgtccaaagccgctgctggcg
gctataaaaaaacagggtgtatccgctgaaagctctgtgcagtccaaacagcaatcctac
agcgcaaccatacctaaatatgacaaggatttcagcgccaagcagcagatcaaggatgcc
atcatggataatgattttctgaagaatattgatgcctcacaggtgcgcgaactggtggac
tcgatgtactcgaagagcattgatgcgggcgagtttgtcattcgtgagggtgaggtgggc
gctcatctatatgtatccgcggcgggtgaatttgctgtcatgcagcagggcaaagtgctg
gacaagatggggccgggcaaggcgttcggtgagctggccatactctacaattgcacacgc
accgcctccatacgggtggtgagcgaggcggcgcgtgtctgggtgctggatcggcgcgtc
tttcagcagattatgatgcgcaccggactgcagcgcattgagaatagcgtgaatttcctg
aagtcggtgccgcttttgcgtaatctcagcgaccaactgctggccaagatagccgatgtt
ctggaattggagttctatgcagcgggcacttatatcatacgccagggcactgcgggcgac
agcttctttctcatctcgcagggcaatgttcgggttacgcagaagttgacgcccgctgcg
ctggaggaaacagagctgcgcaccttaagccgcggggattactttggagaacaggcgctc
atcaatgaggataagcgtacggcgaatatcatagccctggcgccgggcgtggagtgtctc
agcttggatagggattcgtttaagcgcctaattggggatctgtgcgagctcaaggagaag
gactacggagacgaggatcgcatgctggccatgaaacaggctcaggctcaacatgaggag
gcatttggtgcgcaggcgcaacaggagtatccggatctaaagctaactgacctggaggtg
gtcagcacgctgggcattggaggttttggacgtgtcgagctggtgaaggcgcatcatcag
ggccgtgaggatatattcgcgctgaaatgcctgaagaagcggcacattgtggacaccaag
caggaggatcacatctatagcgagcgcagtattatgctcagctccaattcccccttcatc
tgtcgtctctatcgcaccttccgggacgagaaatatgtgtatatgctgctggaggcatgc
atgggcggcgaaatctggaccatgctgcgcgatcacggctcctttgaggataatgcggca
cagtttatcattggctgcgttttgcaagcctttgagtatctgcacgcacgtggcatactc
tatcgggatctgaagcccgagaatctgatgctggatgagcgcggttatgtgaagctggtg
gattttggctttgccaagtatattggcaatagcgccaaaacgtggacgttctgtggcaca
ccggagtatgtggcgccggaaatcatactgaacaagggacacgatcgcgccgtggactat
tgggcactgggcatactcattcacgaactgctcaatggcgctccaccctttaccgctccc
gatcccatgcagacgtacaatctcatccttagaggcattgatatgatcacctttcccaag
cacatctcacgctgggccgtgcagctaattaagcgcttgtgtcgggatgtaccctccgag
cgtctgggctatcaaactggcggcatacaggacatcaagaagcacaaatggtttctgggc
ttcgattgggatggccttgccagtcagctgctgataccgccctttgtgcgacccatcgct
catcccacggacgtgcgttactttgatcgttttccctgtgatcccagcgagccgccggat
gagctctccggctgggatgcggacttttag

DBGET integrated database retrieval system