KEGG   Drosophila virilis: Dvir_GJ19969Help
Entry
Dvir_GJ19969      CDS       T01066                                 

Definition
GJ19969 gene product from transcript GJ19969-RA
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dvi  Drosophila virilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dvir_GJ19969
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dvir_GJ19969
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     Dvir_GJ19969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1687 aa AA seqDB search
MLVEGLRWLYKSTRRNFYALIHILMGYQFFRWLLEYYAQLTTGPVNGGMQQQQQQQQQRQ
QVQSFDKVPAQANTELREEEEAAAKATATVTVKATATATAVPAESAPVSISANELSATAV
MGNAGSSSISRSGVGRSKPLKKHHSEVFKMSKDIESHSIPIAEGTNAEHVLYRLKRGSTL
RVHPDVSLLGRKILLHTNYPDEGKKFVRTEYRVLGWQLRNGQQITSDKHPDVHVVDTDIY
SELQLNLSGTFRFYFRFADREAKPDAPPDGALYVQVEPTLHVGPVGAQKIIPLNSIRCQT
VMAKLLGPLHTWEAKLRVAKESGYNVIHFTPIQELGGSRSGYSLRDQLSVNPNFAAKKGE
RVTFDDVEKVIKKCRQEWGVASICDIVLNHTANESDWLLKHPDATYSCATCPYLRPAFLL
DAALAQCSEDIAAGKLEHVGVPEIIDQECHLEALKYQLHHAYLSKVNIHELYQCDVMKYV
NEFMSQVRTREPPKNVAKESRFQEIQLIQDPAYRRLGSTIDFELALDIFNAFHGDCFDEE
SRFRKCAETLRHHLDALNDQIRAELQGHLNYAIENCLAGVRYERVQQDGPRVREISITHP
VFMTYFTHTRTEGKSLQEIEEDMYGPAGEFFMAHNGWVMGSSDPLLDFAEEQVNRGNVYL
KRELIAWGDSVKLRFGKRPEDSPYLWQHMTEYVEKTARIFDGVRLDNCHSTPLHVAEYLL
DAARKINPELYVVAELFTNSDGTDNVFVNRLGITSLIREALSAWDSHEQGRLVYRYGGVP
VGGFFANPNRDAAPSVAHALFLDLTHDNPSPIEKRSVYDLLPSSALVAMACCATGSNRGY
DELVPHHIHVVDEERPYQEWGKGVDFKTGIVAAKRALNILHGQLAEEGFSQVYVDQMDPN
VVAVTRHSPNTHQTVILVAHTAFSYPHPNAGATNVRPLRFEGVLDEIILEANLTMKSDKP
FDRPAPFKREEHVLNGFTQFELSLQEHIPLSKSQVFETSLYTDGNNTQLNFANLRPGTVV
AIRVSMHPSARKSFDRLQQVTNSLRLESGAQCEELKSIVSKLDLPALSRALFSCDQEERD
MGLGGSAYDIPNFGPIVYCGLQGFVSLLTEISPRDDLGHPLCNNLRDGNWMMDYIADRLN
NFADLKPLSNWLRATFDPLKNVPRYLIPCYFDTIVSGVYNVLVNQVNQLMPDFIRDGHNF
TQSLALSTLQFLAVCNSANLPGFSLALSPPKPPKQCVTLSAGLPHFSTGYMRCWGRDTFI
ALRGTMLLTGRFTEARFIIIGFASAMRHGLIPNLLDNGVKPRFNCRDAVWWWMHSIAQYV
NEAPKGAAILNDKVSRIFPYDDSEPHPPGAFDQLLQDVMQEALQVHFQGLQYRERNAGQE
IDAHMVDQGFNNHIGVHPDTGFVFGGNSANCGTWMDKMGSSEKAGNRGRPSTPRDGSAVE
LVGLQYAVLRFMQGLSERKIIPHSGVERKGPSGELTKWSYKEWADRIQNNFDANFFVKDT
DRTSVANKKGIYKDSFGATQDWTDFQLRCNFPITLTVAAELCDPKNAWRALEQARKYLLG
PLGMKTLDPDDWNYRANYDNSNDSTDCTVAHGANYHQGPEWVWPIGFYLRARLIFAKKCG
YLDETIAETWAILRAHLREMQTSHWRGLPELTNDNGSYCNDSCRTQAWSVGTVLEVLHDL
HALGADV
NT seq 5064 nt NT seq  +upstreamnt  +downstreamnt
atgctagtcgagggtctcaggtggctctacaagagcacacggcgcaatttctatgcactg
atccacatcctaatgggctatcagttctttcgctggctcctcgaatactatgcgcaacta
acaacgggaccggtaaatggcgggatgcagcagcagcagcagcagcagcagcagcggcag
caagtgcaaagctttgataaggtgccggcacaagcgaatactgaactgagagaagaagag
gaagcagcagctaaagcaaccgcaacagttacagttaaagctacagctacagctacagct
gtgccggctgagtcggcgccagtgtcgattagtgcaaatgagcttagtgccacagcagtt
atggggaatgcaggcagcagtagcatcagccgctccggagtcggacgcagcaaaccttta
aaaaaacaccacagtgaggtttttaaaatgagcaaggacatcgaatcgcacagcataccc
attgcggagggcacaaatgctgagcatgtgctttaccgtttgaaacgcggctccacattg
cgcgtgcatccggatgtctcgctcctgggccgcaaaatcctgctgcacaccaattacccg
gatgagggcaagaagtttgtgcgcaccgaatatcgcgtgctcggctggcagttgaggaat
ggtcagcaaataaccagcgataagcatccggatgtccatgtggtcgacacggacatttac
agcgagctgcagttgaacttgtcgggcacgttccgattctactttaggttcgccgatcgg
gaagccaagccggacgcacctccggatggcgcgttgtacgtacaggtggaacccacgctg
cacgtgggtccagtgggcgcccagaagataatacccctcaattctatacgctgtcaaacg
gtgatggccaagctgctcgggcccctgcacacgtgggaggcaaagctgcgcgtggccaag
gagtccggttataatgtcatacactttacgcccatacaggagctgggcggatcacggtcc
ggctactcgctgcgcgatcagttaagtgtcaaccccaactttgcggccaagaagggcgag
cgggtcacgtttgacgatgtggagaaggttattaaaaagtgccgtcaggaatggggcgta
gcttccatttgtgatattgtgcttaatcatacggccaacgaatccgattggctgctgaag
catccggacgcgacttactcgtgcgccacatgcccctatttgcgtcccgcttttctgttg
gacgctgcgctggcgcagtgcagcgaagacatagccgctggcaagctggagcatgtgggc
gtgcccgagattatcgatcaggagtgccatttggaagctttaaagtaccaattgcatcat
gcctacctatccaaggtcaatatacacgaactgtatcagtgcgacgtgatgaagtacgtg
aacgagttcatgtcgcaggtgcgcacacgtgagccgcccaagaatgtggcgaaggagtcg
cgcttccaggagattcaactgatacaggacccggcatatcgtcgcttgggtagcacaatt
gactttgagctggcattggacatctttaatgctttccatggtgactgtttcgatgaggag
tcgcgtttccgcaaatgcgccgagacactgcgccatcatctggatgcgctcaacgaccag
atcagagctgagctccagggccatctcaactatgccatcgagaactgcttggcgggcgtg
cggtacgagcgcgtccagcaggacgggccgcgtgtccgggaaatctccattacgcatccg
gtgtttatgacctactttacgcatacccgaaccgagggcaaatcgctgcaggagattgag
gaggatatgtacgggccggcaggcgagttctttatggcccacaatggctgggtgatgggc
tccagtgatccgctcttggactttgccgaggagcaagtaaatcgcggaaatgtttatctg
aagcgtgagctaatcgcctggggcgacagcgtcaagctgcgtttcggcaaacgcccggag
gacagtccctacctgtggcagcacatgaccgagtatgtggagaaaacggcgcgtattttc
gacggcgtacgcctggataactgtcattcgacgccgctgcacgtggccgagtatctgctg
gatgcggcacgcaaaatcaatcccgagctttatgtggtcgccgagctatttaccaactct
gacggcaccgacaatgtcttcgtcaaccggctgggcattacgtctcttatacgagaagct
ctctccgcctgggattcccatgagcagggtcgtctggtttaccgttacggtggcgtaccg
gtcggcggcttctttgcgaatcccaatcgcgatgcagcgcccagcgtggcgcatgcgctc
ttcttggacctgacacacgacaatccgtcacccattgagaagcgttcagtctacgacctg
ctgccctcatcggcgctggtggccatggcctgctgtgccacgggcagcaaccgcggctac
gatgagctagttccgcatcatattcatgtggtcgatgaggaacgcccttatcaggagtgg
ggcaagggcgtggactttaaaacgggcattgtggccgccaagcgcgccttgaatatactg
cacggccagctggcggaggaaggtttcagtcaggtgtacgtggaccaaatggatcccaat
gtggtcgccgtgacgcgtcactcgcccaacacacaccagacggtcatcctggttgcccac
accgcgtttagctatccgcatcccaatgcgggcgccaccaatgtgcgcccgctgcgattc
gagggggtactggacgagattatactcgaggccaacttaaccatgaaaagcgacaagccc
ttcgatcgtccggcccccttcaagagggaagaacatgtgctgaatggcttcacacagttc
gagctgtcgctgcaggagcacataccgctcagcaagtcgcaagtattcgagacgagcctc
tacacggatggcaacaacacccagctcaactttgccaatctgcgtcccggcactgtggtc
gccatccgcgtctccatgcatcccagcgctcgcaagagcttcgatcgcctgcagcaggtg
acgaactcgctgcgccttgagtcgggtgcccagtgcgaagagcttaaatcgattgtctcc
aaactggatttacctgccttgagtcgggcactgttcagctgtgatcaggaggagcgcgac
atgggcctgggtggctccgcctatgatatacccaactttgggcccattgtgtactgtggc
ctgcagggctttgtctcgctgctgacggagatttcaccacgcgatgacctgggccatcca
ctgtgcaacaatttgcgtgatggcaactggatgatggattacattgccgatcgtctaaat
aactttgctgatctgaaacccctgtccaactggcttagggcaacctttgatccgttgaag
aacgtgccacgctaccttataccctgctactttgataccattgtgagcggtgtctacaat
gtactggtcaatcaggtcaatcaattgatgcccgattttatacgcgatggtcataacttt
acacaatccctggcgctctcgacgctccagttcctggccgtttgcaattcggcgaatctg
ccgggtttcagtcttgcgctcagcccaccaaagccgccgaagcagtgcgtcaccttgtcc
gccggcctgccccacttttccacaggctacatgcgctgctggggccgggacacgttcatc
gcactgcgcggcacaatgctgctcacgggtcgctttacggaggcgcgctttatcataatt
ggctttgcatcggccatgcgtcatggcctgatccccaatttgttggataatggcgttaag
ccgcgcttcaattgccgcgatgcagtctggtggtggatgcacagcattgcccagtacgtt
aacgaggcgccgaagggtgccgctatactcaacgataaggtgtcacggattttcccgtac
gatgattccgagcctcatccgcccggcgccttcgatcagctgctgcaagacgtcatgcag
gaggcactgcaggtgcacttccagggtctgcagtaccgggaacgcaatgctggccaggaa
atagatgcgcacatggtcgatcagggatttaacaatcatatcggagtgcatccggacacg
ggcttcgtgtttggcggcaacagcgccaactgcggcacctggatggacaaaatgggctcc
tcagagaaggcgggcaatcgcggacgacccagcacaccgcgcgatggctccgctgtggaa
ctggttggcctgcagtatgccgtgttgcgtttcatgcagggactcagcgagcgaaagatt
attccgcacagcggcgtggaacgcaagggcccgtcgggcgagctgaccaagtggagctac
aaggagtgggcagatcgcatacagaacaattttgatgcgaacttctttgtcaaggacacg
gacagaacatctgtggccaacaagaagggcatctacaaggatagctttggagccacgcag
gactggacagactttcagctgcgctgcaactttcccataacgctaacagttgccgcggag
ctgtgcgatccgaaaaacgcctggcgtgccctggaacaggccagaaagtatctgcttggc
ccgttgggcatgaagacactggacccggatgactggaactacagagccaattatgataac
tccaacgattcgacagactgcaccgtagcacatggcgccaactatcatcagggtcccgaa
tgggtgtggcccataggcttctatctgcgcgcccgcctcatattcgccaagaagtgcggc
tacctggacgaaaccattgccgagacgtgggccatattgcgggcacatctgcgagagatg
caaacatctcattggcgcggcctgcccgagctgaccaacgacaatggaagctactgcaac
gactcctgccgcacgcaggcctggagcgtgggcacagtgcttgaggtgctgcacgatctg
catgcgcttggcgcggatgtctag

DBGET integrated database retrieval system