KEGG   Drosophila virilis: Dvir_GJ20018Help
Entry
Dvir_GJ20018      CDS       T01066                                 

Definition
GJ20018 gene product from transcript GJ20018-RA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dvir_GJ20018
Transfer RNA biogenesis [BR:dvi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dvir_GJ20018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 556 aa AA seqDB search
MKQKKKLAVGLSREERQVLVIGEIIQELLKAHEDKKDVNLNRMKSLISSKYGLDSSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALP
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDMLNY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCETFNMGKDAGYKIVTHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTVCRDVRTREVGIQEIHNKVRPY
EIELIRRDYVANGGWETFISYEDPEQDILVGLLRLRKCSPDTFRPELQGECSIVRELHVY
GSVVPVSSRDPTKFQHQGFGTLLMEEAERIAREEHGSTKIAVISGVGTRNYYRKLGYTLD
GPYMSKSLSKQYNYRS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaaaaagaagctggctgtcggtctcagtcgcgaggagcgtcaggtgcttgtc
atcggtgaaatcatacaggaactactaaaggcacacgaagacaagaaagatgtgaatctg
aatcgcatgaaatcgctaatatcatcgaaatatggactggacagctcgccgcgacttgtg
gacatcatagcagccgtgccgcaggatgccaagaagatactgctgcccaagctgcgtgcc
aagcccatacgaaccgcaagcggcattgccgtggtggctgtcatgtgcaagccgcatcgc
tgtccgcacatcaattttacgggcaacatttgcgtctattgccccggcggaccggacagc
gatttcgagtactccacacaatcgtatacgggctatgagccgacctcaatgcgcgccata
cgggcacgttatgatccattcctgcagacacgccatcgcgtcgagcagcttaagcagctg
ggccactccgtggacaaagtggagttcattgtgatgggcggcacatttatggccctgccg
gaggaatatcgtgattactttatacgaaatctgcatgatgctctctctgggcacagcagc
gctaatgttgcggaagcggtgcgttattccgagaagtcccggaccaaatgcattggcatc
acaattgagactcggccggattattgcctgaagcgtcacatctccgatatgctgaattat
ggctgcacacgcctggagatcggcgtgcagtccgtctatgaggatgtagccagggacaca
aatcgtggtcatacggtgcgcgccgtttgcgagacattcaacatgggcaaagatgccggc
tacaagattgtcacacacatgatgcccgatctgcccaatgtggattttgagcgcgacatt
gaacagttcatcgagtactttgagaatcccgcttttcgctcagatggcctcaaaatctat
cccacacttgtcatacgtggcactgggctctacgagctgtggaaaacgggtcgctacaag
tcgtatccaccctcgatgctggtcgatttggtggccaaaatactggctctggtgccaccc
tggacacgcgtctatcgtgttcagcgtgacatacccatgcctctggttagctcgggcgtg
gagcacggcaatctgcgtgaattggctctggcgcgcatgaaggatttgggcacggtttgc
cgggatgtacgcacacgcgaggtcggcatccaagagatacacaacaaggttcgtccgtat
gaaatcgagctgataagacgcgattatgtggccaacggcggttgggagacgttcatctca
tacgaggatcccgagcaggatatacttgtgggcctgttacgcttgcgcaaatgctcaccg
gacaccttccggccggaactgcagggagagtgctccattgtgcgcgaactacacgtttac
ggctctgtagtgccggtcagctcacgtgatccaaccaagttccagcaccagggctttggc
acgttgctcatggaggaggcggagcgtattgcccgcgaggagcatggcagcacaaagatc
gcggtcatctcgggtgtcggtacgcgcaactattaccgcaaactgggctacaccctagac
ggcccctacatgtccaagtcactctcaaaacaatacaattatcgctcttaa

DBGET integrated database retrieval system