KEGG   Drosophila virilis: Dvir_GJ20029Help
Entry
Dvir_GJ20029      CDS       T01066                                 

Definition
GJ20029 gene product from transcript GJ20029-RA
Orthology
K03946  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
dvi  Drosophila virilis
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:dvi00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 95 aa AA seqDB search
MRISFASFAAFTAKLKEVRIILDPKCDASKGAREYIQKFYPNLKRHNPNLAFLVRECAGV
HPRLWARYGKGKEVSISLRNQSAPDIQKHLEAVGR
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgcgtataagttttgccagttttgcggcttttacggctaaactaaaggaagtgcgcatt
atattagatccaaaatgtgatgcttccaagggcgccagggaatatattcagaaattttat
cccaatctgaaaaggcacaatcccaacttggccttcttggtaagagaatgcgccggcgtg
catccgagactatgggcacgctatggcaaaggcaaggaagtctcaatctcgctgagaaac
caatccgctccagacatacagaagcacttggaggcggttggcagatga

DBGET integrated database retrieval system