KEGG   Drosophila virilis: Dvir_GJ20283Help
Entry
Dvir_GJ20283      CDS       T01066                                 

Definition
GJ20283 gene product from transcript GJ20283-RA
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 490 aa AA seqDB search
MMTNAIIRELVKRGHEVTFITPFSLAKENLGSNYTEVLIPQYDIWGSVMGMTKAKTALDM
RDLDTVTFIKLAYVMGLGSTDFAFEQKEVLNFINAKDKVGKYDLLLAEQFFNEGALILGH
LYQIPIITISTFGFSNYLTSLTGIINPWSYVAHGWKPYTDRMTLWQRIDSVYGSLVEEAM
RTFWYYPAQNQILQKHFSKQFKELPTIKQLERNISAILLNSYLPLEPPKPISFNMIPVGG
LHIRSAKPLPTNMQNFLDDAKHGAIYFSLGSQVRSADFPPEKIKMFLGVFGNLKQRVLWK
FEDDKLPGLPANVMVQKWMPQNDILAHPNVKVFISHCGLFGTQEAVHYGVPVLGMPVYAD
QHLNIKKGTAAGYALEVNYLTVTKEELQSSLTELLENPKYRDNMKRASRIFRDRPLPAMD
TAMFWIDYVIEHRGAPHMVSAGLDLAWYQFYLLDIIGIALAIILLPILGLILACRHFKPA
KKPKTKSKQN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaacgccattatcagagagttggtgaagcgcggacacgaggtgacattcatc
acgccattctcattggccaaggagaacttgggttccaattacacggaggttctaattcca
caatacgacatttggggctcagttatgggaatgaccaaagccaagacggcgctggacatg
agagatttggacacggtgacattcatcaagctggcctatgtcatgggcttgggtagcacg
gactttgcgttcgagcagaaggaagtgttgaatttcatcaatgccaaggacaaggtgggc
aaatacgacttgctgctggccgagcagttctttaacgagggagctctcattttgggacat
ctgtatcaaatacctatcattaccatttcaacctttggcttctccaactatttgacttcc
ttgacgggcattataaatccctggtcgtatgtggctcatggctggaagccctacacagat
cgcatgaccctttggcaacgaattgacagcgtttacggctcgcttgtagaggaagcaatg
cgcaccttttggtactatccggcacaaaatcagattttgcagaaacacttctccaagcag
ttcaaggagctgccaaccattaagcaactggagcgtaacatctcagccatccttctgaac
tcatatttgcctttggagccgcctaagcccatttcattcaatatgattcccgtgggtgga
cttcatattcgatcagcgaagcccttgcccacaaacatgcaaaattttttggatgatgct
aaacatggggccatatactttagtctgggttctcaagtgcgcagtgcagactttccgcct
gagaagatcaagatgtttctcggtgtgtttggaaacctgaagcaacgcgtcctatggaag
tttgaggacgacaagttacccggtcttccagctaatgtgatggtccagaagtggatgccc
caaaatgatatactcgcgcatcccaatgtcaaggttttcatttcccattgtggtcttttc
ggcactcaggaggcggtacactacggcgttcctgtgctcggcatgcccgtctatgccgac
cagcacttgaatatcaagaagggcacagctgctggttatgcccttgaagtcaattatctc
acagttacaaaggaggagctgcagtcttcccttacagagctgctggagaatcccaagtac
agggataacatgaagcgtgcctcgcgcatctttcgcgatcgtccgctgcctgcgatggat
acggccatgttctggatcgattatgtcattgaacaccgtggagcaccgcatatggtatct
gcaggcttggacctggcttggtatcagttttatctgttggacatcattggcattgccttg
gcaattatacttttgcctattttgggtctgatcctcgcctgtcgccatttcaagcctgcg
aagaagcctaaaacaaagtccaagcaaaactaa

DBGET integrated database retrieval system