KEGG   Drosophila virilis: Dvir_GJ20303Help
Entry
Dvir_GJ20303      CDS       T01066                                 

Definition
GJ20303 gene product from transcript GJ20303-RA
Orthology
K04437  
filamin
Organism
dvi  Drosophila virilis
Brite
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dvir_GJ20303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1618 aa AA seqDB search
MDVKDIKGAKVTHAGLLKHNTDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVENLQTRPLKPSWNRRPANQHHYL
ENATTALKSIEADHIKLVNIGNVDIVNGNVKLILGLIWSLIVRYQIGRSKFPPRKLMLAW
LQAALPDCKITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTNAMNLAQRE
FGVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKEPVKNFTTDWN
DGRVLCEIIKGLGGSAPAPDKLSTDPFHYENNIRKAVDAGAKLGVQPILTPKDMANPEVE
HLGIMAYAAHLQWVPPRPPLSDLVNVYLESTSGRVGEPTHFRIDVLSRDISLSSVRCHVV
PPSGNPGQPVRLNAHGEGVYVPERYGMHEIVVEIGEDSLGGHFFRVLPRLLQVAPPGMAP
CALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKPDEAGIWEIA
ITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVNGELHVDIVHDK
HSLVCSVEKIVDNKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKGRSGKTRSSP
LHESKHRSESPSMHFISTTNTRHNDYRNASLSRRDLHGHNTAERTSSYSPQYSPKLDTTD
YHTSSSRYYKRESEENHGSPTPPLPPTTSGSPTVKYLNSTDLYTESAGGRRDSKTSNSSS
TRNDYYYDKENELYSQRRIVSKPKLAPPREERELTTNSNSSSSFQRHQQLTSSLSPIPSP
TLNTRSSELHSHSPLTIKTSNQYESSTRNITSSPRHASASPVQRYSPNNAYISTATHRIG
SPVTSTLNKNGYESTRVEKSSTYKSTSNYVTDSNVRASPSLYGTAERLRRIGSPEPRIDH
SSNVRVSSLKPASARRDSWDVINKTKHMLSHNSLESLANMTETQLNTELNYARPDLDHET
QRNTQYNKFALHKQQQQQQQQQLQSDYRRDSPDDVDRYKPSAITVKSHSNNTYTDKSGGY
IKTVKESSEHVVTESNGHSSANGPGYGYSSLSRFRPIDSNATGARAIRVQDIPNGSIGRP
VEFEIDGSKAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGTHTVQITFNGETVP
GSPWHAEIMSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPSKSKLN
ARVTHEAANGAARIEFVPTEVGTHIIDASINGTKIAGGPLIAKVYDASLIQVTEVNGGVV
GQPCQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIKFNGE
TVRGCPFVCAVADTSRVLLNLSNLELIPVNRPSSFHITVSGGGAAELAVSVRGPLGELPV
RVTGDIHAGFTAEFTPTSVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVSRGTMGR
PVQFTVDAGDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTINVSFNKM
PVPGCPITVSISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGRRNLLY
NT seq 4857 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaagatatcaagggcgccaaggtgacgcacgcgggtctgctcaagcacaat
acagatggcaccaccgagacccaaaagatcacacatgccggcctggtggcgcgcagtccc
gaaggcaccgccgccaagggcatgaatatacgcggcaacgaagacctgtgggtggaaatc
caagcgaacacctttcgcaattgggtcaacgagcatttgcgcgagacgggcatgcaggtg
catgactgggctacggacttctgcgatggcacctgtctgtgtgcgctggtcgagaacctg
cagacgcgtccgctgaaaccatcctggaatcgccgcccggccaatcagcatcattatctg
gagaatgccacaaccgctctcaagtcgattgaggcggatcacataaagctggtgaacatt
ggcaacgtggacattgtcaacggcaacgtgaagctgatattgggcctcatctggtcgctg
attgtgcgctaccaaatcggacgcagcaagtttccgccgcgcaaactcatgctggcctgg
ctgcaggccgcgctgccggattgcaagattaccaatctcacaacagattggaatagcggc
gtcaacttggccgcgttgctggactactgccagccgggcctgtttccgcactggcgcagt
ctcgatcctagtcagagtgtgcgcaattgcaccaatgccatgaatctggcgcagcgcgag
tttggtgtgcctaaggtgctagagcccgagtatttggcctcgccttggctggatgagcta
tccggcatgacgtatttgtcgtacttcatgaaaccaggtggacccggctacaatgccacc
atgcgttgggttaacacacaggttaaggagcccgtcaagaattttacgaccgattggaac
gatggacgcgtgctgtgcgaaatcatcaagggactgggcggctcggcgccagcgccagat
aagctgagcaccgatccctttcactatgagaacaatatacgcaaggctgtcgacgctggc
gccaagctgggcgtacagcccatattgacgcccaaggacatggcgaatccggaagttgag
catctgggcatcatggcatatgcagcccatctgcagtgggtgccgccacgtccaccgctc
tccgacctggtcaacgtttatttggagagcacatccggccgtgtgggcgaaccgacgcat
ttccgcatcgacgtgctgtcgcgggacatcagcttgagttcagtgcgctgtcacgtggtg
cccccgtccggtaatcccgggcagccggtgcgtttaaatgcgcatggcgagggcgtttac
gtgccggagcgctatggtatgcacgagattgttgtggagattggcgaggatagcctggga
ggtcatttcttccgcgtgttgccgcgtctcctgcaggtggcgccacctggcatggcgccc
tgcgccctgggcagcctggtcgaggtgctagttaatgcaacaggcgcgcccaaaacggaa
gatattctggtcacagcagtttcgccgacgggcatctcgcacaactgtccgctgaagaag
atcgacgagggacacagtgccatattcaagccggatgaggcgggcatctgggagatagcc
atcacctatcagggccgtcacatccaaggcggtccattcacctgtgccgtgttcgatgcc
tctggcgtctctgtacatggcctggatggcgccatgccgctgcgggctcacaccttcgag
gtggacgcacgcggcgtgggagtcaacggcgagctgcatgtggacattgtccatgacaag
cactcgctggtctgctctgtggagaagatcgtggataacaagtatcgggtgacctttatg
ccgcgtcagaatggcaaatatcgcgtgtatatctacttcaatggctacgatgtcaagggc
tcgcccttcatcatgcgcgtgggcactaaaggtcgctcgggcaagacacgcagcagtccg
ctgcatgagagcaaacatcgctcggagagcccctcaatgcacttcatctccacgacaaat
acgcgtcacaatgactatcgcaatgcgtcgctttctcgtcgggatttgcacggccataac
acggccgagcgcaccagcagctactcgccgcagtattcacccaagctagacacaaccgac
taccacacttccagctccaggtactacaagcgcgagagcgaggagaaccacggctccccc
acaccgcccctgccgccaacgactagcggctcccccacagtgaaatatttgaactcgacg
gacctttacacggaatctgccggtggtcggcgtgactcgaagacctccaatagcagctca
actcggaatgactactactacgacaaggagaacgagctgtatagccagcggcgcatcgtc
agcaagcccaagctggcgccgccgcgcgaggagcgcgagctaaccaccaacagcaacagc
agcagcagcttccagcgacaccaacaactgaccagctcgctcagtccaatacctagtccc
acactgaatacgcgctccagcgagctgcactcccacagtccgctgactattaagacatcg
aatcagtacgagagctccacacgcaacataaccagcagtccgcgtcacgcctccgcctcg
ccggtgcagcgctattcgcccaacaatgcgtacatcagcacggccacacatcgcataggc
agtcccgtgaccagcaccctgaacaagaacggatacgagtcaacgcgcgtggagaagtca
tccacctacaaatccacctcgaactatgtcaccgattcgaatgtgcgcgccagtccctcg
ctctatggcacagccgagcgactacgtcggattggctcgccggagccgcgcattgatcac
tcctcgaatgtgcgcgtctcttcgctgaagccggcgtcggcgcgtcgcgatagctgggat
gtcatcaacaaaaccaagcatatgctctcgcacaattcgctcgaatcgctggcgaacatg
accgagacgcagctcaacacggagcttaactacgcacgccccgatctggaccacgagacg
cagcgcaatacacagtacaacaaattcgcattgcacaagcagcagcagcagcaacagcag
caacagcttcagtcggactaccgacgcgactcgcccgacgacgtggatcgctacaaaccc
agtgccatcaccgtcaagtcacactcgaacaacacgtatacggacaagtccggcggctat
atcaagaccgtcaaggagtccagcgagcatgtggtcacggagagcaatggccatagctcg
gctaatgggccgggctacggctacagctcgctgtcacgctttcgacccatagacagcaat
gcgacaggtgctcgggccatacgcgtacaggacatacccaatggctccattggacgtccg
gtggaatttgagatcgatggctccaaggccggttccggcaatctggaaattttggttaat
ggcggccgggtcacatcgtcggtccgctcgctgggcggccagcgctttatagccagcttc
acgccacacgaacatggaacacacaccgtgcagatcactttcaatggagaaacggtacca
ggttcaccgtggcacgctgagatcatgtcgtcacccggcctaaccgctctgggcgaatcc
acacgccttgtgcccgccaatacgccggcggtttttgagatactgccgcctcctggacaa
agcctgagcaaaggcgagtgcgtggcaacggtcttgactccaagcaagtcaaagctgaat
gccagagtcacccatgaggcggcaaatggtgctgcacgcattgagttcgtgcccaccgaa
gtgggcacgcacatcattgatgcgtccatcaatggcacgaagatcgctggcggtcctttg
atagcaaaggtctacgatgccagcctgatccaagtgaccgaggttaatggcggcgtggtt
ggccagccatgccagtttcgtgtggacgccagtgcggctggtgagggacagctggagata
tccataaatgagggcgaggtgcccaaccatgtccaggtcgttggcggcggtcgttgtctc
gtctccttcacccccgagcaggcgaagtcccatttgatagacatcaagttcaatggggag
acggtgcgcggctgcccctttgtctgtgccgtggcggacacctcgcgtgttcttctcaac
ctgtccaatctggagctgataccggtcaacaggccctcgtcctttcacatcacggtgagc
ggtggtggagccgctgaactggcggtcagcgtccgtgggccactcggcgagttgcccgtc
cgcgtcactggcgatatacatgccggcttcacggcggagtttacgcccaccagcgtcggc
ggccactcgataaatgtggagtacaatggctttgcggtacagggcacaccatttctggcc
aagtcatatgatgccagcaaggtggtcgttggtagcgtctcccgtggcaccatgggtcga
cccgtgcagttcactgtggatgcgggcgatgctggcgagggcaatctagagataaccata
tcggccaagggtcaaaatatacccacacaggtgcatccccagggcagtgcaagattctcc
gtttcgtttgtgccgacagagtcgtgcgagcacacgattaatgtctcctttaataaaatg
cccgtgcccggctgcccaataacggttagcattagcggcggcgtagccgggccccaggta
tcccttggcggtcccgggccggtgcatcagaccaattcttttgttatcaatcacaatggc
ggccgtttggaagacattgaggtcaacgtcgaaggacggcgaaatcttttgtactag

DBGET integrated database retrieval system