KEGG   Drosophila virilis: Dvir_GJ20304Help
Entry
Dvir_GJ20304      CDS       T01066                                 

Definition
GJ20304 gene product from transcript GJ20304-RA
Orthology
K04437  
filamin
Organism
dvi  Drosophila virilis
Brite
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dvir_GJ20304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1377 aa AA seqDB search
MCTLQNRGNSGPAGQSVPAQVHQSAEGVFKAEFVPRVVGEHRVNVTVNGLPTAGSPYAAK
VYDVSAIKVKNVSSGTVGKPVTFLVETSQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISF
TPREAESHTVELRFNSQDVPGSPFTCRVAAAARIQSPETMDKVSVGRLFEFVVESDTKPT
VEVLGPARRSVPVKIDALGSTLGYNVKFEPMEVGDHSVEVRLPGGGHVEGSPFLLKAYSA
EKVIVTDIRPGVVNKSVSFGINASQAGAGNLEIIVAVNGKNVPNFVQSEGNARFKVNFKP
TEAAAHSLSVRFNGHPVPGSPFSCHIAAAAASSSGVPRAQALGECLKQAAVKMDNTFELE
GFEGIEPQIFVTSPAGDNEHCQLSQHDGGSYSASFRPSTVGRHLISVLANDQHINGSPFS
CNVFDVSRVSISGLEQQYGPATLGVPVTFSVDAAGAGEGTLELVVSTDSSTVKAEVVACA
RGLYDVTFVPQSTEPHYVNITFNEVAVDGSPFRVDIQQHTQHIQIGSLAAIDFPADDQIV
EILAPDQKPVPYTINRQTAEFRTHMTGNYTLRFIDRETRQHIGTRTLCAFDPMLVKITEV
GEALCHRPASISVSLNEAGQGDLSALVRCGVTEVPHTIRGPSKSGVYEIVYQPTRVAPHK
ISILFNDVPISLKPLEINVLPASAGKEISVSGLGLYQARVGKTTSFAIDTVKRPAREFDV
VVSGPGGQALPVRCYQTKNGHLQAEFSINKPGQCVIEVLHQSKPLPGSPFTCEAFDSSKV
TVQGVTKEPLALHSSNSFTVRTDNAGTAELEAFAISPTNQSLPVLISEQSEGIYNVEFVP
SQPGNYKLTLMYGGETIPSSPLNFSASSSGVRNDARAAGHGLEVCHRNKEASFVVYCPIA
PNVQIERVDEFGERIEPKIKALGNNEWRISYVILSVGTYEIRASCPNRGSLPGSPWRICC
VESTKVTPVGGWGTLVDHDGRLILPARIIFDMENAGPGKLVCSIDGIEIPVDKLADGKMC
LNITGDNLAAGEHDLDLTWSGLTITQCPRSAFVTGQQAADKVVLMGRGLAAAQAGEAAHF
TIDASNAPAGRPEVILITQENTALPVSLAQPRPSENIWLASYTPQKSMTGTLTLSVKWNG
RLVKGCPLTVAVGSSMDASKVIASGEGLRHGIVGKDIKSWIDTRRAGPGELTAHCAGARK
VAYCELYDHGDATFTLNIKPQEPGRHLLTIKYGGQNVPGSPFALKVAGAPDASKVRVYGP
GIEHGVLATFQSRFICDTRGAGAGQLTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEP
GDYRVEVKWAGEFVPGSPFPVMIFDTEEELRSGLTPPIRYQPAAATQQSRRAACVPL
NT seq 4134 nt NT seq  +upstreamnt  +downstreamnt
atgtgcacattgcaaaatcggggcaactcaggtcccgccggacaatctgtgcccgcccag
gtgcatcagtccgccgagggtgtcttcaaggcggagtttgtgccccgagtcgtcggcgaa
catcgcgtcaatgtcactgtcaatggtttgcccacagctggcagtccctatgcggctaag
gtttatgacgtcagcgccatcaaggtgaagaatgtgagcagtggaacggtgggtaagcct
gttaccttcctggtcgaaacttcccaggctggtcccggcaatctggaagtcacagtaaac
ggcggtcgtgtgcccacctcggcacaggcacagggccagcacacatatgctatcagcttt
acaccacgcgaagctgagagtcacacggtggagctgcgtttcaacagccaggatgtgcct
ggctcaccattcacgtgccgggtggcggccgcagcacgcatacaatcgcccgagaccatg
gacaaggtcagcgtgggtcgcctcttcgagtttgtggtggaatcagacaccaagccaacg
gtggaagtgctcggcccggccagacgaagtgtcccggtgaagatcgacgcactcggctca
acgctgggctacaatgtcaagttcgagcccatggaggtgggcgatcattcggtggaggtg
cgactgcctggcggcggtcatgtggagggcagtcccttcctgctgaaggcctactccgcc
gaaaaggtaatcgtaacggacatacgacctggcgtggtcaacaagagcgtcagctttggc
atcaatgcctcccaggcgggcgccggcaatctggagatcattgtcgccgtcaacggcaag
aatgtgcccaactttgtgcaatccgagggcaatgcgcgtttcaaggtgaacttcaagccc
acagaggcggctgcccattcgctttccgtgcgcttcaacggacacccggtaccgggatca
ccctttagctgccacatagcagctgctgccgccagttcttcgggcgtgccacgcgcccag
gcgctgggcgaatgccttaagcaagcggccgtcaagatggacaacaccttcgagctggag
ggctttgagggcatcgagccacagatatttgtcacgtcgcccgccggtgacaacgagcac
tgtcaactgagtcagcacgatggcggcagctacagcgcctccttccgacccagcacagtg
ggccgccatctgatcagcgtgttggcgaatgatcagcacataaatggatcacctttcagc
tgtaatgtgttcgacgtctcccgcgtgagcatcagcggcctggagcagcagtatggacct
gccacgctgggggtgcctgtcaccttcagtgtggatgcagctggcgcaggggagggcaca
cttgagctggtggtgtccaccgacagcagcactgtcaaggccgaggtggtcgcctgtgct
cgcggcctctacgacgtcacctttgtgccacagagcaccgagccgcattatgtgaatatt
acgttcaacgaggtcgccgttgacggcagtcccttccgcgtggacatacagcagcacacc
cagcacatacagattggcagtctggcagccattgattttccggccgacgatcagattgta
gagatactggcgcccgatcagaagcccgtgccgtacaccatcaatcgccagacggcggag
ttccgcacccacatgaccggcaactacacgctgcgctttattgaccgcgagacgcgtcag
cacattggcacccgtacgctctgcgcctttgatcccatgctggtcaagatcaccgaggtg
ggcgaggctctgtgtcatcgtccggccagcatcagcgtgtcgctcaacgaagccgggcag
ggtgatctgtcggcgctggtgcgttgcggtgtcaccgaggtgccgcacaccatacgcggc
cccagcaaatcgggcgtctacgagattgtctaccagcccacgcgtgtggcgccgcacaag
ataagcatactctttaacgatgtgcccatatcgctgaagccactcgagattaatgtgctg
cctgccagcgctggcaaagagatcagcgtcagcggtctgggcttgtatcaggcgcgggtg
ggcaagaccacatcctttgccattgacacagtgaagcggccggcgcgagagttcgatgtt
gtggtctccggacccggtggccaggcgctgcccgtgcgctgctatcagaccaagaatgga
cacctgcaggcggagttcagcattaataagccgggtcaatgcgttatcgaggtgctgcat
cagtcaaagccactgccgggcagccccttcacctgcgaggcgtttgacagcagcaaggtc
actgtgcagggcgtcaccaaagagccactggcgctgcacagctccaatagcttcaccgtg
cgcacagacaatgccggcactgccgagctggaagcctttgccatttcgcccactaaccag
agcctgcccgtgctcatcagcgaacagtccgagggcatttacaacgtagagtttgtgccc
tcccagccgggcaactataagctaacgctcatgtatggcggcgagacgattcccagctca
ccgcttaacttcagcgcctcgtcgagtggcgtgcgtaatgatgcacgcgctgctggacac
ggcttggaagtatgtcatcgtaacaaggaggcctcctttgttgtctattgtcccattgca
cccaatgtgcagattgaacgcgtggacgagtttggcgaacgcatcgagcccaagatcaag
gcgctgggcaacaacgagtggcgcatctcatatgttattttatcggtgggcacctacgag
attcgtgccagctgccccaaccgcggcagtttgcccggctcaccttggcgcatctgctgc
gtggagtccaccaaggtcactcctgttggcggctggggcacgctggttgatcatgacgga
cgtttaatattgccggcacgcattatcttcgatatggagaatgccggtcccggcaagctg
gtctgcagcatcgatggcattgaaatacccgtcgataagctggccgatggcaagatgtgt
ctcaacatcacgggcgacaatctggccgccggcgagcatgatctggatttgacctggagc
ggtttgaccatcacacagtgtccacgcagcgcctttgtaacgggtcagcaagccgccgac
aaggtggtgctaatgggtcgcggactagccgccgcccaggccggcgaggcggcgcacttt
accatcgatgcctccaatgcgccagccggccgcccggaagttattttgatcacgcaggag
aatactgcgctgcccgtgagcctggcacagccgcggcccagcgaaaacatttggctggcc
tcgtacacgccgcagaagtccatgacaggcactctgacgctgtcggtcaagtggaatggc
cggctggttaagggctgcccgctcactgtggccgttggctcctccatggacgcctctaag
gtcattgcgtccggtgaaggtctgcgccacggcattgtcggcaaggacatcaaatcctgg
atagacacccgacgcgccggacctggcgagctaaccgcccactgcgccggcgcacgcaag
gtggcctactgcgagctgtatgaccatggtgatgccacctttacgctgaacattaagcca
caggagccgggacgtcatctgctgaccatcaaatacggcggacagaatgtgcccggctca
ccatttgcgctcaaagtggccggcgcaccagatgccagcaaggttcgcgtttatgggccc
ggcatcgagcatggtgtgctggccaccttccaatcgcgattcatatgcgacacacgtggc
gctggcgccgggcagctgacggtgcgcgtgcgcggacccaagggtgccttccgcgtggaa
atgcagcgcgagagccaaaaggatcgcaccattctgtgcaaatacgatccaacggagccg
ggtgactatcgcgtcgaagtcaagtgggctggtgaatttgtgcccggttcgccgttcccc
gtcatgatcttcgacaccgaggaggagttacgaagtggcctgactccgcccattcgctat
cagcctgcggctgccactcagcagtcgcgtcgtgccgcctgtgttccactctag

DBGET integrated database retrieval system