KEGG   Drosophila virilis: Dvir_GJ20545Help
Entry
Dvir_GJ20545      CDS       T01066                                 

Definition
GJ20545 gene product from transcript GJ20545-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dvi  Drosophila virilis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dvi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 270 aa AA seqDB search
MKPQVNEQNGSTQNGDIATDAASVAMDAAAIVPAAVAASAGTVVPAKSSQQLKLEMLNMG
NGNGHENCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKA
MLYFTKGYDQNLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNK
ILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKI
NSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcaagttaacgaacaaaatggtagcactcaaaatggcgacattgccaccgat
gctgccagcgtcgccatggacgctgccgcgatcgtgccagccgcagttgccgccagcgca
ggcaccgttgttcctgccaaaagcagtcagcagctgaaactggaaatgcttaacatgggc
aacggaaatggccacgagaactgcacctttcatcacgatctggagctggaccataagccg
ccgacgcgcgaggccctgctgcccgatatggcgcgctcgtaccgcctgctgctgggcggc
ctgggcgagaatcctgatcgccagggcctgatcaagacgccggagcgcgccgccaaggcc
atgctgtactttaccaagggctacgatcagaacctggaggacgtgctgaacggcgcggtc
ttcgatgaggatcatgatgaaatggtcgttgtcaaggacattgaaatgttttcaatgtgt
gaacaccatttggtgccattttatggcaaagtgtccatcggctatttgccatgcaataag
attctaggacttagcaagctggctcgcattgtggaaatattttcgcgtcgtcttcaggtc
caggagcgtttgaccaagcaaattgccgttgctgtgactcaagcggtgcagccagctgga
gttgctgtcgttgtcgagggcgtacacatgtgcatggtcatgcggggtgtgcagaaaatc
aatagcaaaactgttacctcgactatgcttggcgtgttccgcgatgatccaaagacgcgc
gaggagttcctaaatctagtcaatagcaaataa

DBGET integrated database retrieval system