KEGG   Drosophila virilis: Dvir_GJ20575Help
Entry
Dvir_GJ20575      CDS       T01066                                 

Definition
GJ20575 gene product from transcript GJ20575-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dvi  Drosophila virilis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dvir_GJ20575
Translation factors [BR:dvi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dvir_GJ20575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MAKKKSEEHSGADANDSDYTEEPNFDDPPNFVDNISDEDLLGDMLAQRPSEADGVESVVV
VDNMPKVEPSRLEKLKSVINKLFSQCGEIVNVVYPVDEEGKTKGYAFMEYKTASQAEDAV
KKLNNHRLDKNYTFAVNLFTDFQKYENIPEKWEPPTVQPFKVQSDLYNFINDPDAYDQYC
VAAETAPNCVQVGFWQNTLPEPNELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSS
FQKIQKFPHPGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGTEKRSFVGDGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMEIPKKRETRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKELDVKFL
GMFYNFEIFHMREKEIPVDSVEIRELILAFAWEPIGNKFSIIHGEPNSSNVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDTTNDYIISASPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTFQGRIIRRTILKNFVQFLWRPRPPTLLSEEKQKE
IKKNLKKYYPVFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIAEWKDQKSRRVMLR
GHVDTDNLETDEVDEEVVEFLVKEEITLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagaaaagtgaagagcattcgggagccgatgcaaacgatagcgattacacc
gaggagccaaacttcgacgatcctcccaattttgtggacaatatcagcgatgaagattta
cttggggatatgctggctcaacgcccatcggaggccgatggcgtcgagagtgtcgttgtg
gtcgacaacatgccaaaagtggaaccgagccgcctcgagaaactaaaatcggttatcaac
aagctgttttctcaatgcggtgaaattgtcaacgttgtctatcccgtcgatgaagagggc
aagacaaagggctatgcgttcatggagtataagaccgcaagccaggctgaggatgcggtt
aagaagctgaacaaccatcgtctggacaagaattacacctttgctgtcaatttgtttaca
gactttcaaaagtatgaaaatataccggagaaatgggagccgccaacggtgcaacccttc
aaggtacagagcgatctgtacaatttcataaacgatcccgatgcctacgatcagtactgc
gtggcggcagagacagctcccaattgcgtgcaggttggcttctggcagaatactctcccg
gaacctaatgagctagagacgcgtgaacgttttactgacacttttgtcaagtggtctcca
ttgggcacgtatgtggtcaccttccacaaacctggagtggccatttggggaggcagcagc
ttccaaaagattcaaaagtttccgcatcctggcactcaattcgttgagttttcgccctgc
gaaaattacttggttacgtatggtccgacgccgaccggccaaaagatcatcatttgggac
atacgcaccggaactgagaagcgttcctttgtgggtgatgggatgtcagtgttgtcaatg
ttccgctggtcgcacgatgacaaatttgtggcacgcatgggcgaaaactcgatacacatt
tacgagacaccatcgttttatttgctggatttaaaatctattaagattccgggcatacgc
ggcttctcgtggtcgcctacggacaacgtaattgcctactgggtggaagaacagaaccag
atacccgcacgcgtgacgctaatggagatacccaaaaagcgggagacacgcaacaagaac
ctcttccatgtggccgactgtaagcttcattggcaaaaatctggcgattatctatgcgtc
aaggttgatcgctactctaagttgaagaaggacaagaaggagctggatgtcaagtttctg
ggcatgttttacaactttgaaatttttcacatgcgcgaaaaggaaatacccgtggattcg
gtggagatacgtgagcttatcctcgcgtttgcctgggagcccataggtaacaagttttcc
attatacacggcgagcccaattcttcgaacgttagcttctatgaggtcaacaagggtgtt
aagccaagcttggtcaaacgcttggagaagaagtcatgcactcatctgttctggtcgcca
cgcggtcagttcatagtgatggccaatcttaccatgggcacctttgagtttgttgataca
accaacgattacatcatcagcgcatcaccggatcacttccgcgcctccgaggtagaatgg
gatccaactggtcgctatgtcgtgactggcgtctcgtcttggaaggtcaaagaggatacg
ggcttcaacatgtacaccttccagggtcgcatcatcaggcgcaccattttgaagaacttt
gttcagttcctctggcgcccgcgaccgccgacgcttctcagtgaagagaagcagaaggag
ataaagaagaacctgaagaagtactatcctgtatttgagcaaaaggatcgcctgcgtttg
acccgtgcctccaaggagctgctcgagaagcgctcacagctgcgtgagactttcatggag
taccgcaacaagcgcattgcagagtggaaggatcagaagagccgtcgcgtcatgctcaga
gggcatgtggatacggataatttggaaaccgatgaagtcgatgaggaagttgttgaattt
ttagtcaaggaagaaataaccctgctagagtag

DBGET integrated database retrieval system