KEGG   Drosophila virilis: Dvir_GJ20850Help
Entry
Dvir_GJ20850      CDS       T01066                                 

Definition
GJ20850 gene product from transcript GJ20850-RA
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dvi  Drosophila virilis
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dvir_GJ20850
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dvir_GJ20850
Peptidases [BR:dvi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dvir_GJ20850
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ20850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 261 aa AA seqDB search
MQGLEALLLCLVVGTTVAGTISPAPNPFEREGRIVGGEDTTIEAHPYQVSLQKKSGSHFC
GGSLISHNLVVTAAHCLQGIKVSSIRVRLGSTRYNEGGLLVTVESLVYNDQYNSQTLAND
VGLLKLAESVAESESIRYIPLAEVTPPTGKPAVVTGWGTKCYFWCMSLPKTLQAVVVYIV
DWKTCASDEYKYGEIVLDTMVCGYEKDKDACQGDSGGPLVANNQLVGIVSWGYGCAGKLL
PGVYADVAALRSWIEENAKTL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtcttgaagcgttgttgctctgcctggtggttggcaccacagtggccggcact
atcagtccagcacccaatccctttgagcgtgagggccgcattgtgggtggcgaggacacg
accattgaggcgcatccctatcaggtttcgctgcagaagaaaagtggctctcacttctgt
ggtggcagcttgattagccacaatttggtggttactgctgctcactgcctgcagggcatc
aaggtgtccagcatacgagtgcgtttgggctcaacccgctacaacgaaggtggtttgctc
gtcaccgtcgaaagtttggtgtacaacgatcagtacaacagccagacactggctaacgat
gtgggtctgctcaagctggcggagagtgtggccgaatcggagtctatacgatatatacca
ttggctgaggtaacaccgccaacaggcaaaccggcagtggtcacgggctggggcaccaag
tgctacttctggtgcatgtccctgccgaagacccttcaggctgtcgttgtctacatcgtg
gattggaagacgtgcgcctccgatgagtacaaatacggggagattgttttggacaccatg
gtctgtggctatgagaaggacaaggatgcctgccagggtgattccggcggacccctggtg
gccaacaatcagctggtgggcattgtgtcctggggctacggctgcgccggcaagctgctg
cctggtgtctacgccgatgtggcagctttgcgcagttggatcgaggaaaacgccaaaact
ttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system