KEGG   Drosophila virilis: Dvir_GJ20863Help
Entry
Dvir_GJ20863      CDS       T01066                                 

Definition
GJ20863 gene product from transcript GJ20863-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dvi  Drosophila virilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dvi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MTDAMQVEVKDIDKLIEMDGYLKPFEREIRRRHGVLKEWIAKIDQCEGGMEEFSQGYKYY
GLHFQPDNSVIAREWAPGARDVYLTGDFNNWHWESHPFKKLPFGKWELHLPANPDGSAPI
KHLSEIKIIIRNQSGQLLDRLSPWAKYVVQPPKSANQGVNFKQYVWQPPAGERYQRQSAR
PAKPKSLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFG
YQVTSFYAASSRCGNPEQLKRMIDVAHSQGLYVLLDVVHSHASKNVQDGLNQFDGTNSCF
FHDGARGEHSLWDSRLFNYTEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIG
EGFSGDYNEYFGLNVDTDALNYLGLANYMLHKLDPEVITIAEDVSGMPTLCRPVSEGGIG
FDYRLGMAIPDKWIELLKEQRDDEWDVGNIVHTLTNRRWMENTVAYAESHDQALVGDKTI
AFWLMDKEMYTHMSTISEPSLIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEWLD
FPRVGNNDSYHYARRQWNLVDDNLLKYKYLNEFDRAMNELEERYGWLHSGPAYVSWKHQS
DKTIHFERAGLVFVFNFHPTQSFSDYRVGTNWAGTYQAVLSSDDPIFGGHNRIDMNCKHQ
SDPWGHAGRSNFIQVYTPCRTAVVYARISD
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgcgatgcaggtggaggttaaggacattgataagctgatagaaatggacggc
tatctgaagcccttcgagcgtgagattcgccgccgacatggcgtcctgaaggagtggatt
gccaagatcgaccaatgcgagggcggcatggaagaattctcgcagggctacaaatactat
ggcctacactttcagccggataattcagtgatagcacgcgaatgggcgccgggcgcaaga
gatgtgtatctgactggcgatttcaacaactggcactgggaatcgcatccgttcaagaaa
ctgccctttggcaagtgggagctgcacttgcccgccaatccagatggtagtgcgcccatt
aagcatctcagtgagataaagatcatcatacgcaatcagtccggtcaactgttggatcgt
ctctcgccctgggccaagtatgtggtgcagccacccaagagcgccaatcaaggtgtcaac
tttaagcagtatgtgtggcagccgccagccggggagcgatatcaacggcagagcgcgcgt
cccgccaagcccaagtcattgagaatctacgagtgccatgtgggcattgcctcgcaggag
ccgcgcgtgggcagctacgatgagttcgccgatcgcattgtgcctcgcattaagcgtcag
ggctacaactgcattcaggtgatggccatcatggagcatgcctattacgccagctttggc
tatcaggtgacaagtttctatgcggcgtccagccgctgtggaaatccggaacagctgaag
cgcatgatcgatgtggctcattcccagggtctctatgtgctgctcgatgtagtgcattcg
catgcatccaagaatgtgcaggatggcctaaaccagttcgatggcacaaatagctgtttc
ttccacgatggcgcccgtggggagcattcgctctgggatagccgtctcttcaactacacg
gagtacgaggtgctccggtttttactgtccaatctgcgttggtggcacgacgagtataat
ttcgatggctatcgctttgatggcgtcacctccatgttatatcattcacgcggcattggt
gagggattcagcggtgactacaacgagtactttggccttaatgtggacacggatgcgctc
aactatctgggcctggccaattatatgctgcacaagctggatccggaggttataactata
gcagaggacgtctctggcatgcccacgttgtgtcgtcccgtttcggagggcggcattggc
ttcgattatcgcctgggcatggccataccggacaaatggatcgagctgttgaaggagcaa
agggatgatgaatgggacgttggcaatattgtacacacactgaccaatcgacgctggatg
gagaacacggtggcgtatgcagagtcgcacgatcaagcgctcgtcggcgataagaccatt
gccttctggctgatggacaaggagatgtacacgcatatgtccacaatatccgaaccttcg
ctaattattgatcgtggcctggcgctgcacaagatgataagactcattacgcacgccctg
ggcggcgaggcgtatcttaattttatgggcaatgagtttggtcatcctgagtggctggac
tttccacgcgtgggcaacaacgactcgtatcattatgcgcgtcgccagtggaatctggtg
gatgacaatctgttaaagtataaatacctaaacgaattcgatcgtgccatgaatgagctg
gaggaacgctacggttggctgcactcgggtcctgcgtatgtgagctggaaacaccagagc
gacaagaccattcattttgaacgcgccggcctcgtgtttgtgttcaacttccacccaacg
caaagttttagtgactatcgtgttggcaccaactgggcgggcacctatcaggcggtgctc
tcctcggacgatcccatctttggcggccacaatcgcatcgacatgaactgcaagcatcaa
tccgatccctggggtcatgccggtcgctccaatttcattcaagtctatacgccttgccgc
acggccgttgtttatgcgcgcatcagcgattag

DBGET integrated database retrieval system