KEGG   Drosophila virilis: Dvir_GJ20948Help
Entry
Dvir_GJ20948      CDS       T01066                                 

Definition
GJ20948 gene product from transcript GJ20948-RA
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 829 aa AA seqDB search
METGSSSSSTSGSTSSSGSSSCTDTGSSSDTDSSSSGVAGPEEKPQPPKTQPSAVRRKAA
ATPADNEKPKAAGNSNSNALTSAASKVRSVVAASNQRNGGMSSDDDDDDDDDAPPAKKNA
RTMNNAVPAAAARRKPSTGAATTKQAAGGAAGGSKVPLPAKGNSQPQRNGDNKRPSLSSS
SNSTDDSHKDVKNGRKVPLKLASTATAVRAKQMRAKALQAKTNSSNNNKNGPAAVRREKS
RSSECSDDSDSGSGSETSSISESEGSDSSNSYSSQPATGKSNPKGKRVVGAGGDSEEERK
DKANPMRKLTRSLSMRRSKQQQLKPGSETETDADLEQEDDKQRVLSKSPAKKSATAAGLN
SSNSNNNNSKCKVKKEMTSLKSRPVSPAVQLEKKCPIEGCDSSGHLSGNLDRHFLPEACP
IYHNMSASECKERANERKLRNEQRLKMPINIVSTPGNQQNNLKSLTPEQREFLAKIRESR
ASFRPMSNSFLNDKVKIDKDCTDEDREPNLAGLVPDYDLQLFREAQAQASERIEDELKDL
PVGKGIKYISMGKYKMKVWYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHAQKCVWR
HPPGDEIYRKGKLQVWQVDGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADV
DGCHIVGYFSKHIPFLQEKNSFYNVSCILTLPPYQRKGYGRLLIDFSYLLTRVEGKIGSP
EKPLSDLGLISYRSYWKDVLLDYLCNRSGNTLCIKDVSQEMAIYSYDIVSTLQALGMMKY
WKGKHIVLKKQDVLDEYEERVKRRGTFPKIDDSCLRWQPFIPAQPSASP
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggaaactggcagcagctcgagctccacgtcgggcagcacttcgtcgagtggctcttcc
agctgcacggatacgggcagctcctcggacaccgattcgagcagctctggcgttgccggc
ccagaggaaaaaccgcagccgccaaaaacacaaccaagcgcagtacgtcgcaaggcggca
gcaacgccagccgacaatgagaagccaaaagccgcaggcaatagcaacagcaatgcgttg
acgtcggccgccagcaaggtgcgttccgttgtggcggccagcaatcagcgcaacggtggc
atgtccagcgacgacgatgacgacgacgacgacgatgcgccgccggccaaaaagaatgcg
cgcacaatgaacaacgcggtgccagcagccgctgctcgacggaagccatcaacaggagcg
gcgacgaccaagcaagcggcgggcggagcagctggcggcagcaaagtgccgctgccggcc
aaaggcaatagccagccgcagcgcaatggcgacaataaacgaccctcgctcagctcctcc
tccaacagcacagatgactcgcacaaggatgtcaagaacggacgcaaggtgccgcttaag
ctggccagcaccgcgacggctgtgcgggccaagcaaatgcgcgccaaagcgctgcaggcc
aaaacgaacagcagcaacaacaacaagaatggacctgctgctgtgcggcgcgagaagagt
cgcagcagcgaatgcagcgatgattcggacagtgggtccggctcggagaccagctccatt
agcgaatcggagggtagcgattcgagcaactcgtatagctcacagccggcgacgggtaag
tcaaatcccaagggtaagcgtgtcgttggcgcgggcggcgacagcgaggaggagcgcaag
gataaagcgaatcccatgcgcaaattgacgcgctcgctgagcatgcgccgttccaagcag
caacagctcaagccgggcagcgagaccgaaacggatgcagatctcgaacaggaggacgac
aagcagcgcgtcctctccaagagtccggccaaaaagtcggccacagccgccggcctgaac
agcagcaacagcaacaacaacaacagcaagtgcaaggtgaagaaggagatgacctcgctc
aagtctcggcccgtctcgcccgccgtgcagctggagaagaagtgccccatcgagggctgc
gattcgtcgggccatttgagcggcaatttggatcgacactttctgcccgaggcgtgtccc
atttaccacaacatgtccgcctcggagtgcaaggagcgcgccaacgaacgcaagctgcgc
aacgagcagcgcctcaagatgcccatcaacattgtcagcacgccgggcaatcagcaaaac
aatctcaaatctctgacgcccgagcaacgcgagttcttggccaaaatacgcgaatcacga
gccagctttcgtcccatgagcaacagtttcctaaatgataaggttaagatagacaaggac
tgcacggatgaggatcgtgagccgaatctcgcgggcctggtgcccgactacgatctgcag
ctgtttcgcgaagcacaagcacaggcctccgagcgcatcgaggacgagctcaaggatctg
cccgttggcaagggcatcaaatacatcagcatgggcaagtacaaaatgaaagtgtggtat
cagtcgccgtatccggatgatgccgcacgcctgcccaagatgtacatctgtgagttctgt
ctgcgctatcagaaatcggagacgggcatcaaacggcatgcccagaaatgcgtctggcgg
catccgcccggcgatgaaatctatcgcaaaggcaagcttcaggtgtggcaagtggatggc
aaacgctacaaacaatattgccagcatctctgcctgttagccaagttctttctggaccac
aagacgctctactatgacgtcgagccgtttctcttctatatcatgaccctggccgatgtc
gatggctgtcacattgtcggctacttcagcaagcatattccattcttgcaggaaaaaaac
tccttttataacgtctcgtgcattctaaccctgccgccatatcagcgtaaaggctacgga
aggctcctcatcgatttcagctatctgctaacccgcgtcgagggcaaaattggttcgccg
gagaagccgttatccgatctgggacttatatcatatcgctcctactggaaggatgtactg
ctcgactatctatgcaatcgctccggcaatacgctctgcatcaaggacgtatctcaggaa
atggccatttattcctatgacattgtgagcactctgcaggcgctgggcatgatgaaatac
tggaagggcaagcatatagtactcaaaaagcaggatgtgctggatgagtatgaggagcgc
gtaaagcgtcgcggcacatttcccaaaatcgacgactcctgtctgcgctggcagcccttt
ataccggcacagccgagcgcatcaccttag

DBGET integrated database retrieval system