KEGG   Drosophila virilis: Dvir_GJ20958Help
Entry
Dvir_GJ20958      CDS       T01066                                 

Definition
GJ20958 gene product from transcript GJ20958-RA
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dvi  Drosophila virilis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dvi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dvi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dvi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dvi00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 513 aa AA seqDB search
MLRSIAAKRNELGALRAVFLRAQAVRRGANCGVRALSSTRNHLANRLTPNGKPILSRPQT
LSPWSYNFARAYANLPEHIRVALPALSPTMDRGSIVGWEKKEGDKLNEGDLLCEIETDKA
TMGFETPEEGYLAKILVPGGSKDVPVGKLVCIIVPDQASIAAFKDFVDDAPAAAPAAAAA
APSPPPPAAAPAPAPAAAAAAAPAPAPAAPAPSPAAAPGTASAPSGGRVYASPMAKKLAE
TQKLRLQGKGSGVHGSLKSGDLAASQPAQKSAAKAAGAAPGARFKDIPVTNMRAVIAKRL
LESKQKLPHYYVTVECQVDKLLKLRAQVNKKYEKQGARVSVNDFIIKAVGVASRKVPEAN
SAWMDTFIREYDDVDVSVAVSTEKGLITPIIFGADRKGVLEISKNVKELAGKARENKLQP
HEFQGGTISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKKLVLDPDSDKGFKEVNMLTV
TLSADHRVVDGAVAAVWLKHFRDYMEDPQTMIL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttacgctcaatcgctgcgaaacgaaatgaattgggcgcactacgcgccgtctttctc
agagcacaggcggtgcgacgtggagccaactgcggagtccgagccttgagcagcacacgc
aaccatttggcaaacaggttaacaccaaatggcaagccgattctcagccgaccccaaaca
ctgtcgccatggagctacaattttgcccgtgcctacgccaacttgccggagcatatacgc
gtggcgctgcctgccctgtcgcccaccatggatcgcggctcgattgtgggctgggagaag
aaggagggcgataagctaaatgaaggcgatttgctatgcgaaatcgaaacggacaaggcc
acgatgggttttgagacgcccgaggagggttatctggccaagattttagtgcccggcggt
tccaaggatgtgcccgttggcaagctggtgtgcatcattgtgcccgatcaggccagcatt
gcggcctttaaggatttcgttgacgatgctcccgctgcagcaccggctgcggctgcggca
gcgccttcaccacctccgccagcagctgcaccagctccagcacccgctgccgctgccgct
gccgctcctgcaccagcgccagcagcacccgcgccaagtccagctgccgcaccaggtacc
gcttccgcgccaagcggcggtcgtgtctatgcaagtcccatggccaagaaattagccgaa
actcaaaagctgcgtttacaaggcaaaggttccggcgtccatggctcacttaaatctggt
gatcttgcagcctcgcaaccagcgcagaagtcagctgccaaggcggccggcgcagcgccc
ggtgcccgcttcaaggacatcccagtgaccaacatgcgcgcagtcattgccaaacgcctg
ctggagtccaagcagaagctgccacactactatgtcaccgtcgagtgccaggtggacaag
ctattgaagttgcgcgcccaagtgaacaaaaagtacgagaagcagggcgcacgcgtttcc
gtcaacgatttcatcatcaaggctgtgggcgtggccagtcgcaaggtgcccgaagccaat
tcggcgtggatggacacattcattagggaatacgacgatgtggatgtgtctgtcgctgtc
tccacagaaaaggggctcattacgcccattatcttcggagccgaccgaaagggtgtgctg
gaaatctcgaagaacgtaaaggagctggcgggcaaggcgcgcgaaaataagctgcagcca
catgaattccagggcggcaccatatccgtgtccaatttgggcatgttcggtgtcaatcag
ttctgcgccgttatcaatccaccgcaatcctgcatcttggccattggcacaacaacgaaa
aaactcgttttggatccggatagcgataagggattcaaggaagttaatatgctaaccgta
acgctgagtgccgatcacagagtggtcgatggcgctgtggctgccgtttggcttaaacat
ttccgcgactacatggaggatccacaaactatgatactgtaa

DBGET integrated database retrieval system