KEGG   Drosophila virilis: Dvir_GJ20958Help
Entry
Dvir_GJ20958      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dvi  Drosophila virilis
Pathway
dvi00010  Glycolysis / Gluconeogenesis
dvi00020  Citrate cycle (TCA cycle)
dvi00620  Pyruvate metabolism
dvi01100  Metabolic pathways
dvi01200  Carbon metabolism
Module
dvi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvir_GJ20958
   00020 Citrate cycle (TCA cycle)
    Dvir_GJ20958
   00620 Pyruvate metabolism
    Dvir_GJ20958
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dvir_GJ20958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF3614 FAP
Motif
Other DBs
NCBI-GeneID: 6628476
NCBI-ProteinID: XP_002052559
FlyBase: FBgn0208093
UniProt: B4LS28
Position
Unknown
AA seq 513 aa AA seqDB search
MLRSIAAKRNELGALRAVFLRAQAVRRGANCGVRALSSTRNHLANRLTPNGKPILSRPQT
LSPWSYNFARAYANLPEHIRVALPALSPTMDRGSIVGWEKKEGDKLNEGDLLCEIETDKA
TMGFETPEEGYLAKILVPGGSKDVPVGKLVCIIVPDQASIAAFKDFVDDAPAAAPAAAAA
APSPPPPAAAPAPAPAAAAAAAPAPAPAAPAPSPAAAPGTASAPSGGRVYASPMAKKLAE
TQKLRLQGKGSGVHGSLKSGDLAASQPAQKSAAKAAGAAPGARFKDIPVTNMRAVIAKRL
LESKQKLPHYYVTVECQVDKLLKLRAQVNKKYEKQGARVSVNDFIIKAVGVASRKVPEAN
SAWMDTFIREYDDVDVSVAVSTEKGLITPIIFGADRKGVLEISKNVKELAGKARENKLQP
HEFQGGTISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKKLVLDPDSDKGFKEVNMLTV
TLSADHRVVDGAVAAVWLKHFRDYMEDPQTMIL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttacgctcaatcgctgcgaaacgaaatgaattgggcgcactacgcgccgtctttctc
agagcacaggcggtgcgacgtggagccaactgcggagtccgagccttgagcagcacacgc
aaccatttggcaaacaggttaacaccaaatggcaagccgattctcagccgaccccaaaca
ctgtcgccatggagctacaattttgcccgtgcctacgccaacttgccggagcatatacgc
gtggcgctgcctgccctgtcgcccaccatggatcgcggctcgattgtgggctgggagaag
aaggagggcgataagctaaatgaaggcgatttgctatgcgaaatcgaaacggacaaggcc
acgatgggttttgagacgcccgaggagggttatctggccaagattttagtgcccggcggt
tccaaggatgtgcccgttggcaagctggtgtgcatcattgtgcccgatcaggccagcatt
gcggcctttaaggatttcgttgacgatgctcccgctgcagcaccggctgcggctgcggca
gcgccttcaccacctccgccagcagctgcaccagctccagcacccgctgccgctgccgct
gccgctcctgcaccagcgccagcagcacccgcgccaagtccagctgccgcaccaggtacc
gcttccgcgccaagcggcggtcgtgtctatgcaagtcccatggccaagaaattagccgaa
actcaaaagctgcgtttacaaggcaaaggttccggcgtccatggctcacttaaatctggt
gatcttgcagcctcgcaaccagcgcagaagtcagctgccaaggcggccggcgcagcgccc
ggtgcccgcttcaaggacatcccagtgaccaacatgcgcgcagtcattgccaaacgcctg
ctggagtccaagcagaagctgccacactactatgtcaccgtcgagtgccaggtggacaag
ctattgaagttgcgcgcccaagtgaacaaaaagtacgagaagcagggcgcacgcgtttcc
gtcaacgatttcatcatcaaggctgtgggcgtggccagtcgcaaggtgcccgaagccaat
tcggcgtggatggacacattcattagggaatacgacgatgtggatgtgtctgtcgctgtc
tccacagaaaaggggctcattacgcccattatcttcggagccgaccgaaagggtgtgctg
gaaatctcgaagaacgtaaaggagctggcgggcaaggcgcgcgaaaataagctgcagcca
catgaattccagggcggcaccatatccgtgtccaatttgggcatgttcggtgtcaatcag
ttctgcgccgttatcaatccaccgcaatcctgcatcttggccattggcacaacaacgaaa
aaactcgttttggatccggatagcgataagggattcaaggaagttaatatgctaaccgta
acgctgagtgccgatcacagagtggtcgatggcgctgtggctgccgtttggcttaaacat
ttccgcgactacatggaggatccacaaactatgatactgtaa

DBGET integrated database retrieval system