KEGG   Drosophila virilis: Dvir_GJ20959Help
Entry
Dvir_GJ20959      CDS       T01066                                 

Definition
GJ20959 gene product from transcript GJ20959-RA
Orthology
K14298  
mRNA export factor
Organism
dvi  Drosophila virilis
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dvir_GJ20959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 349 aa AA seqDB search
MFGPAQTTTNRMNDFEVASPPDDSVSALEFSPSTLQVPKNFLIAGSWDNSVRCWEVEQNG
ATVPKSMKTMGGPVLDVCWSDDGTKVFMASCDKQVKLWDLASDQVMQVAAHDGPVKTCHM
VKGPNYTCLMTGSWDKTLKFWDTRTPNPMMAINLPERCYCADVDYPMAVVGTAGRGLIIY
SLENSPTEYKRQESPLKYQHRTISIFKDKKKTPTGYALGSIEGRVAIQYVNPVNPKDNFT
FKCHRSTGTSGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSEAMDQSI
TKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRVN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggcccgcacaaacgacaacaaatcgtatgaacgattttgaggtggcatcgccg
cccgatgactccgtctctgcgcttgagttcagtccaagcacattgcaagtgccaaagaat
ttcctcattgccggcagctgggacaacagcgtgcgctgttgggaggtggaacaaaatgga
gccacagtgccaaagtcaatgaaaacaatgggtggaccagtgctcgatgtgtgctggtcc
gatgacggaaccaaagtgtttatggcttcctgtgacaaacaagtcaagctttgggatctc
gcctccgatcaggtaatgcaagttgctgcccacgacggaccagtcaagacttgccacatg
gtaaaagggccaaattatacgtgcctgatgaccggctcctgggataaaacgctcaagttt
tgggacacgcgcacacccaatcccatgatggccattaatctgcctgaacgctgctattgt
gcagatgtggactatcccatggccgtggtgggcactgcgggccgtggcctgatcatttac
tcgctggaaaacagtcccaccgagtacaagcgacaggagagtccgctgaaataccagcat
cgcaccatatcgatatttaaggacaagaagaagacgcccacaggctatgcgctgggcagc
atagagggacgcgtggccatacagtacgtgaacccagtaaatcccaaggataactttaca
ttcaagtgccaccgctcgacgggtacctcgggcttccaagatatctacgcggtaaacgac
attgcattccatcccgtgcatggtactttggttacagtgggatcggatggcacattcagt
ttctgggacaaagatgcacgaaccaagctcaaatccagtgaagccatggatcaatctatt
acgaaatgcggcttcaatgccaatggccaaatattcgcatacgctgtcggatacgactgg
tccaagggacatgaatactttaatccggccaaaaaaccacagattttcctgcgctcctgc
tatgacgagctaaagccgcgcgtcaactga

DBGET integrated database retrieval system