KEGG   Drosophila virilis: Dvir_GJ20959Help
Entry
Dvir_GJ20959      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K14298  mRNA export factor
Organism
dvi  Drosophila virilis
Pathway
dvi03013  RNA transport
Module
dvi_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dvir_GJ20959
Messenger RNA biogenesis [BR:dvi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dvir_GJ20959
Chromosome and associated proteins [BR:dvi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dvir_GJ20959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Nup160 ANAPC4_WD40 eIF2A
Motif
Other DBs
NCBI-GeneID: 6626481
NCBI-ProteinID: XP_002049075
FlyBase: FBgn0208094
UniProt: B4LPN0
Position
Unknown
AA seq 349 aa AA seqDB search
MFGPAQTTTNRMNDFEVASPPDDSVSALEFSPSTLQVPKNFLIAGSWDNSVRCWEVEQNG
ATVPKSMKTMGGPVLDVCWSDDGTKVFMASCDKQVKLWDLASDQVMQVAAHDGPVKTCHM
VKGPNYTCLMTGSWDKTLKFWDTRTPNPMMAINLPERCYCADVDYPMAVVGTAGRGLIIY
SLENSPTEYKRQESPLKYQHRTISIFKDKKKTPTGYALGSIEGRVAIQYVNPVNPKDNFT
FKCHRSTGTSGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSEAMDQSI
TKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRVN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggcccgcacaaacgacaacaaatcgtatgaacgattttgaggtggcatcgccg
cccgatgactccgtctctgcgcttgagttcagtccaagcacattgcaagtgccaaagaat
ttcctcattgccggcagctgggacaacagcgtgcgctgttgggaggtggaacaaaatgga
gccacagtgccaaagtcaatgaaaacaatgggtggaccagtgctcgatgtgtgctggtcc
gatgacggaaccaaagtgtttatggcttcctgtgacaaacaagtcaagctttgggatctc
gcctccgatcaggtaatgcaagttgctgcccacgacggaccagtcaagacttgccacatg
gtaaaagggccaaattatacgtgcctgatgaccggctcctgggataaaacgctcaagttt
tgggacacgcgcacacccaatcccatgatggccattaatctgcctgaacgctgctattgt
gcagatgtggactatcccatggccgtggtgggcactgcgggccgtggcctgatcatttac
tcgctggaaaacagtcccaccgagtacaagcgacaggagagtccgctgaaataccagcat
cgcaccatatcgatatttaaggacaagaagaagacgcccacaggctatgcgctgggcagc
atagagggacgcgtggccatacagtacgtgaacccagtaaatcccaaggataactttaca
ttcaagtgccaccgctcgacgggtacctcgggcttccaagatatctacgcggtaaacgac
attgcattccatcccgtgcatggtactttggttacagtgggatcggatggcacattcagt
ttctgggacaaagatgcacgaaccaagctcaaatccagtgaagccatggatcaatctatt
acgaaatgcggcttcaatgccaatggccaaatattcgcatacgctgtcggatacgactgg
tccaagggacatgaatactttaatccggccaaaaaaccacagattttcctgcgctcctgc
tatgacgagctaaagccgcgcgtcaactga

DBGET integrated database retrieval system