KEGG   Drosophila virilis: Dvir_GJ21108Help
Entry
Dvir_GJ21108      CDS       T01066                                 

Gene name
Dvir_ST6Gal
Definition
(RefSeq) sialyltransferase
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dvi  Drosophila virilis
Pathway
dvi00510  N-Glycan biosynthesis
dvi00514  Other types of O-glycan biosynthesis
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dvir_GJ21108 (Dvir_ST6Gal)
   00514 Other types of O-glycan biosynthesis
    Dvir_GJ21108 (Dvir_ST6Gal)
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     Dvir_GJ21108 (Dvir_ST6Gal)
Glycosyltransferases [BR:dvi01003]
 Terminal extension
  Sialyltransferase
   Dvir_GJ21108 (Dvir_ST6Gal)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 DUF2816
Motif
Other DBs
NCBI-GeneID: 6625423
NCBI-ProteinID: XP_002048818
FlyBase: FBgn0086001
UniProt: Q0E5A1
Position
Unknown
AA seq 452 aa AA seqDB search
MVQVKKQRATRPAATLISALLLGALLIQGEAASTADEAQRVHEPNAAAARAAVVNMASVE
TRNAAPHRLPRSVFHVRWNPNEKFIVESRESPAINSSKLAPHPRLKVSKNTKLTLSPKLY
LCHDKYAAECHNKTASFRRRIVQSFERSMSEALNESNHYNVDYKPVFGDSFEEQYYPSSC
LVMEAGVRVLRRKDAPFNKLPFGRLFPRQKLFRNVKSVKSCAIVSSAGSLAGSKLGRFID
NHDIVMRFNHAPTRGHEVDVGSKTTIRVVNSQVVTKPEFDFAHAPIFRNVTIAAWDPGRY
NGTLEDWLTTADYDLFTNYEIYRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRSIRRNPP
SSGFIGLALLLPHCPQVDFVEYVPSTRLNGRCHYYSKEMNSACTFGSWHPLAAEKLMALD
MNVADDMSVFQFGILRIRRPDKLLCGFNFFGY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagtaaagaaacaacgtgcaacgcggcctgcggcaacgttaatcagcgccctg
ctgctgggcgcattattaattcaaggcgaggcagcgtcaacggcggacgaagctcagcga
gtgcacgaaccaaatgctgcggcagcgcgcgctgctgtggtgaatatggcgtcagtcgag
acgcgcaatgccgcgccgcatcgcctgccgcgcagcgttttccatgtacgctggaatccc
aatgagaaattcattgtggagagtcgcgaaagcccggccataaattcatccaagctggcg
ccgcatccgcgcctgaaggtgtccaagaacaccaaactgacgctcagtccgaagctgtat
ctgtgccacgacaaatacgcggccgagtgccacaacaagaccgcctccttccggcgccgc
attgtgcaatcctttgagcgctcgatgagcgaggcgctcaacgagtccaatcactacaac
gtcgactataagcccgtatttggggacagtttcgaggagcagtattatccctccagctgc
ctggtgatggaggcgggtgtgcgcgtcctgcgccgcaaggatgcgccgttcaacaagctg
cccttcggtcgcctctttccgcgccagaaactgtttcgcaatgtgaagagtgtcaagagc
tgtgcgattgtctccagcgccggttcgctggcgggctccaagctgggacgcttcatagat
aaccacgacatcgtcatgagattcaatcacgcgccaacccgcggacacgaagtggatgtg
ggcagtaagaccacaatacgtgtcgtcaattcccaagtggtgaccaagccggagtttgat
tttgcgcatgcgcccatctttaggaacgttacgattgccgcctgggatccgggacgttac
aatggcaccctcgaggattggctgaccaccgccgattacgatttgttcaccaactacgag
atctacaggcgccgttatcccaaatcacgcgcctttctcatcgatccgcattcggtgtgg
cgcctgtggcaaagcctgcaaatgtttgccggcaatcgatccatacgacgtaatccaccc
agttccggttttataggcttggccttgttgttgccgcactgtccccaggtggactttgtg
gaatatgtgccctccacacgactcaacggacgctgtcactactacagcaaagagatgaac
tccgcctgcacattcggctcttggcatccgctagccgccgaaaagctgatggcgctggac
atgaatgtggccgatgatatgtccgtcttccagttcggcatcctgcgcatccggcgaccc
gacaagctgctctgcggctttaacttcttcggttactga

DBGET integrated database retrieval system