KEGG   Drosophila virilis: Dvir_GJ21253Help
Entry
Dvir_GJ21253      CDS       T01066                                 

Definition
GJ21253 gene product from transcript GJ21253-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dvi  Drosophila virilis
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dvir_GJ21253
   00053 Ascorbate and aldarate metabolism
    Dvir_GJ21253
   00500 Starch and sucrose metabolism
    Dvir_GJ21253
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dvir_GJ21253
   00860 Porphyrin and chlorophyll metabolism
    Dvir_GJ21253
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dvir_GJ21253
   00982 Drug metabolism - cytochrome P450
    Dvir_GJ21253
   00983 Drug metabolism - other enzymes
    Dvir_GJ21253
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dvir_GJ21253
Glycosyltransferases [BR:dvi01003]
 Others
  Hydrophobic molecule
   Dvir_GJ21253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 531 aa AA seqDB search
GLPVLGLSRLSLLLLLLLGSNCRAAKILVLFPHASESHFAVMRTLVAELAGREHNVTVYG
GHGLGERLERVAETVVAPEYDFWSNLQQHAAAGGSLEDLARLSDSRLRSSLAQVGAQALD
HFLAQPSLQALLQLPSAEFDYDVIIVDYFYTEALLALGYKHNKPTIGIVSTDFGNYMNTV
QEALVPVACSPIDFEAYTSELGFAARLANIRECISRRKQFHKEHYAAQEKLIRKHFKIAA
NVPQLQAQHLALLLLNTHVPLWTPRPLVQQIVPAGGLHIRGPRELPWHIKRYAEESRDGI
IYMQLGNEQLCGQLPKEKLRILFEFIGGRKERFIWTCHDVTTLESLPKNSMIQHGVPQID
ILAHPRVRAFIMNGDLLSLQEGIMRHVPMLGLPSFQNERKNMQLAVSLGVGLQLEQSNFT
KAALDWALDELTTQQDYQLAIREVSSEFRDRPLGALANAMFWVNYVVRHKGGAAIRTRGI
DIGSNQLHLFDLFVFYFALAIVICAVLVAVYFGVVYALQRKRNDAKLSKLS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
ggactgcctgtgctaggcctttccaggctcagcctgctgctgctgctgctgctgggtagc
aactgtcgcgctgccaagatacttgtcctgtttccacacgccagcgagagtcactttgct
gtgatgcgcaccctggtcgccgagctggccggccgggagcacaatgtaactgtttacgga
ggccacggcctgggcgagcgcttggagcgcgtggcggagactgtcgtcgcgccggaatat
gacttttggagcaacttgcaacagcatgcagcagctggcggcagcctggaggacttggcc
cgcctgtcggacagcaggctgcgcagctccttggcccaggtcggcgctcaggccttggat
cactttctggcgcagccgtcgttgcaggctttgctgcagctgcccagcgctgagtttgac
tacgatgtgattattgtcgactatttctacacggaggcgctgctagcgttgggctataag
cacaataagcccaccattggcattgtgagcacggatttcggcaactatatgaacacggtg
caggaggcgctggtgcccgtcgcctgttcgcccatcgattttgaggcgtatacgtcggag
ctgggttttgcggcgcgcttggccaacatacgcgagtgtatttcgcgacgcaagcaattt
cacaaggaacactacgcggcacaggagaaattaatacgcaaacattttaaaattgcagcc
aatgtgccgcaactgcaggcacagcatttggctttattgctgcttaatactcatgtgccc
ctgtggacgccacgcccattggtgcagcaaattgtgcccgcaggtgggctgcatatacgc
ggaccgcgcgaattgccctggcatataaagcgctacgcggaggaatctcgcgacggcatc
atctacatgcagctgggcaatgaacagctctgcggtcagctgcccaaagagaagctgcgc
atactctttgagtttattggcggacgcaaggagcgtttcatttggacctgccacgatgtg
acgacgctggagagtctgcccaagaatagtatgatacagcatggcgtgccacagattgac
attttggcgcatccgcgcgtccgcgcatttatcatgaatggagatctgttgagcctgcag
gagggcattatgcgtcatgtgcccatgctgggcttgcccagcttccagaatgaacgcaag
aacatgcagttggcagttagcttgggcgtcggcctgcagctggagcagagcaatttcacc
aaagccgctctcgactgggctttggacgagctcacgacgcaacaggactatcagcttgcc
attcgggaggtgtccagcgagttccgggatagaccgttgggcgccttggccaatgccatg
ttctgggtaaactatgtggttcggcataagggcggcgctgcgatcagaacacgcggcata
gatattggctcaaatcaattgcatttatttgatttgtttgttttttactttgctttggcg
attgttatatgcgccgttttggttgccgtctattttggagttgtatatgccctgcaaaga
aaacgtaacgatgcaaaattatcaaaattaagttag

DBGET integrated database retrieval system