KEGG   Drosophila virilis: Dvir_GJ21270Help
Entry
Dvir_GJ21270      CDS       T01066                                 

Definition
GJ21270 gene product from transcript GJ21270-RA
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dvir_GJ21270
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ21270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1330 aa AA seqDB search
MGTKVQQNDDAAAAAPAAEAAATHSNANANATATTTTARAAEAEADAAATASATTTPTQT
TTELKSQTLPTHSAAPTQVLIIPAAQASTMATNAAKKIRRAFSMPRNPFRWSRKFKTIAA
TAGTAADGSSVNVGSASNTAISSCVSGGRGRSGSIVSLSSYEAASDAPIGKDKPNRAATI
AVTNNNNNSNGSSSSNNNNNSKRASGQQARVLRRSSFRKFLNRIAQHLSATVNVGSPENN
TAQHRTTFIEIVPFYTGCWRRKEANKHGQASMGNGSANGGTERVPPIGGYQWPADQTPGV
MGLKNHGNTCFMNAVLQCLSHTDILAEYFVLDQYKADLKRRNKINSRKFGTKGELTEQLA
NVLKALWTCRNESDHSTSFKAVVDRYGTQFRSSTQHDAQEFLFWLLDKVHEDLNTASKRR
YKSIKNSYGRSDEIIAAETLANHIRCNNSFVQAVFQAQFRSSLTCPRCQKQSNTFDPFHC
ISVQLPQLTQVTIFVTVVFMKQQPRQLKMGLRVPAGSPIVALREQLQETGIAPDRMVLVD
LSSEGFTRVFYDTQPVETLSSVENIYCIEVPEVSPAPKASLDAAPADAVEKPTAAASHST
DLLLLVANVHRTTAGAEAGEADGKDVCTRFGAPFSMKAPKDCSYQELQKRMLREMSAILK
PEVFSYATPLTDMFKIRLQDPSADPDTYLEQVEHPLLTEMIDMALSVLSSEAGPTHIKLL
LEWSTPETHFVQLQSDTDAIVEHESVARLSASKPNDTAALTLEQCLEHYTKAETLSAEDA
WRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFRQHQAKGPQAAKLTTMVKFPLTAFDMSP
HLARGVRECNGGNGLGHAMEQSNKKSRSGDSRSSTLNSRTEPKDTRYDLYAVCYHQGDTL
ETGHYTAACKNPYDRRWYKFDDQRVSKVPEVDIEQDIINNEAYMLFYQRRSVDPAAECSG
SSSNSGDHWVSRIAPPTSAAAKEKDVATTTTEAPEPVPVAAEKSTAPKAVALPIPIPIVA
CEIEEEPEDVAAADAKSASAHDLLNIEALAFADADPEMESAPPAELKAEPAAPLSTTSTP
QPLPEPENAAVEEADAAQIFAMDEDCPDKQREAAAARETAPTSAATEPASESPTPAEPTT
NGHAASSGTSSASSSASSVSSLSPRSLNTSVTAASTLQSKFNGHMTLLNGNATPQLSSSL
QLSRHALHNHHCNHNWHGSRSSVSAIESVTQQQQQQQQQQQQQAAAASLSLRHSFSTSSN
YKLRDCSETLSSLLRNSANTCSKDTLLFIDQQNHHHTSGLIEDDDDTYMGRSLWISPVTP
HKLITVSPKN
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgaaagtgcaacaaaacgacgacgctgccgccgcagcgccagcggcagaagcg
gccgccacccacagcaacgccaacgccaacgctacagcgacaacaacaacagcaagagca
gcagaagcagaggccgatgcagcagcaacagcaagcgcaacaacaacaccaacgcaaaca
acaacagagctaaagtcacaaacgctgcccacacatagcgcagcgccgacgcaagtgtta
atcattcctgccgcccaggcttccacgatggccacaaatgccgccaaaaagatacgacgc
gccttctccatgccacgcaatccgtttcgctggtcgcgcaaattcaagacgattgctgcc
acagccggcacagctgccgatggcagcagcgttaacgtcggcagcgccagcaacacggcg
atttcgtcctgtgtgagcggcggtcgcggacgcagcggcagcattgtttcgctcagcagc
tatgaggcggcctctgatgcgcccatcggcaaggacaagccaaatagggcggcgaccatt
gcagtcaccaataacaacaacaacagcaacggcagcagcagcagcaacaacaacaacaac
agtaaacgtgcgagcgggcaacaagcacgtgtgttgcgtcgctcttccttcaggaaattt
cttaatcgcatcgcgcagcatttaagcgcaacggtgaatgttgggtcgcccgagaacaac
acggcgcaacatcgcacaacttttatagaaattgtgccattctataccggatgctggcga
cgaaaagaggcgaataaacatggccaagcgagcatgggaaatgggagtgcgaatgggggc
acggaacgtgtgccgcccattggtggctatcaatggcccgcggatcagacgcccggcgtg
atggggctaaagaatcatggcaacacctgcttcatgaacgcggtgctacaatgcctcagc
cacacggacatcctagccgagtactttgtgctggatcagtacaaggcggatctgaagcgt
cgcaacaagatcaactcgcgcaaatttggcaccaagggcgaactaaccgagcagctggcc
aatgtgctgaaggccttgtggacctgccgcaacgagagcgatcacagcaccagcttcaag
gcggtcgtcgatcgctatggcacacaattccggagctcgacgcagcacgatgcgcaggag
tttctgttctggctgttggacaaggtgcacgaggatctgaataccgcgagcaagcggcgc
tacaagagcatcaagaactcgtacgggcgctcggatgagataattgccgccgagaccttg
gcgaatcatatacgctgcaacaatagctttgtgcaggccgtgtttcaggcacagtttcgc
tcctcgctgacgtgtccgcgctgccagaagcagtccaataccttcgatccgttccactgc
atatccgtgcagctgccgcagctcacccaggtgaccatctttgtgactgtggtctttatg
aagcaacagccgcgccagctcaagatgggcttgcgtgtcccggccggttcgcccattgtt
gcgctgcgcgagcagcttcaggagacgggcattgcccccgaccgcatggtgctggtggat
ctcagctcggagggattcacacgtgttttctacgacactcagcccgtggagacgctgagc
agcgtggagaacatatactgcattgaggtgcccgaagtgagtccagccccaaaggcctcc
ttggatgcagcgcctgcggatgccgtagaaaagccgacggcagctgcgtcacattccacg
gatctgctgttgctcgtggccaatgtgcacaggacgacggcaggagcggaagcgggcgag
gctgatggcaaggacgtgtgcacgcgctttggtgcacccttcagcatgaaggcgcccaag
gattgcagctaccaggagctgcagaagcgcatgctgcgcgagatgtccgcaatcctcaag
ccggaggtattttcctatgcaacgccgttgacggatatgtttaagatacgtctccaggat
ccctccgccgatccggatacgtatttggagcaggtggagcatccgctgctcaccgaaatg
atcgatatggcgctctcagtgctctcctcagaggcgggacccacacacattaagctgctg
ctggagtggagcacgcccgagacgcatttcgttcagctccaatcggatacagatgccatc
gtggagcacgagagtgtggcgcgcctaagcgccagcaaacccaacgataccgccgccctg
acgctggagcaatgtctggaacattataccaaagcggagacgctcagtgcggaggatgcc
tggcgctgtccgcattgccagcagtatttgcccgtggtcaagaccctgggcctctggtcg
ctgcccgacattttggttgtgcactttaagcgcttccgccagcaccaggccaagggaccg
caggcggccaaactgaccaccatggttaagtttccgctcaccgcattcgacatgtcgccg
catttggcccgcggcgtgcgcgagtgcaacggcggcaacggcctgggtcatgccatggag
cagtccaacaagaagtcacgctctggcgactcacgctcctcgacgttgaattcccgcacg
gagcccaaagatacgcgctacgatctgtatgccgtctgctatcatcagggcgatacgctg
gaaacgggccactatacggcagcctgcaagaatccatatgatcgccggtggtacaagttt
gacgatcagcgcgtgagcaaagtgcccgaggttgacattgagcaggacatcatcaacaat
gaggcctatatgcttttctatcagcgacgcagcgtcgatccagccgccgagtgttccggc
tccagttccaattcgggcgatcattgggtctcgcgaattgcaccgcccacatcagctgct
gccaaggagaaggacgttgcgaccacgaccacggaagcgcctgagccagttccagtcgca
gctgagaagtcaaccgcgcctaaagctgtggctctgcccattcccatacccattgttgct
tgcgaaatcgaagaggagcctgaggatgttgctgcagcagatgctaagtccgcttcagct
cacgacctgctgaacattgaggcattagcttttgcagatgcagatcccgagatggagtca
gctccgccggctgagttaaaggctgagcccgctgcgcctttatccacgacttcaacgcca
cagccgttgcctgaacctgaaaatgctgccgtagaagaagctgatgccgcgcaaatcttt
gccatggacgaagactgcccggacaagcagcgtgaggcagctgctgcacgcgaaaccgcg
cccacctcggcggccactgagccagccagcgaatcaccaacgcctgcggagcccacaaca
aatggccatgcggccagctcgggcacatcctcagcgtccagttcagcttcatcggttagc
tcactctcgccacgctcgctaaacacctccgtgacggcggctagcacgttgcaaagcaaa
ttcaatggccacatgacgctgctcaatggcaatgcgacgccgcagttgtcttccagcctg
cagctgtcgcggcatgcgctgcacaaccaccactgcaaccacaattggcacggctcacgc
agcagcgtctcggccatcgagagtgtcacacagcaacagcagcagcagcagcagcaacaa
cagcagcaggcggcagcggctagcctaagtctgcggcactcattctccaccagctccaat
tataagttgcgcgactgcagcgagacgttgtcttcgctgctgcgcaactcggccaacacg
tgcagcaaggacacgctcctcttcatagatcagcagaaccatcatcacacgagcggcttg
atcgaggacgatgacgatacgtacatgggtcgctccttgtggatatcgcccgttacgcca
cataagttaattaccgtctctcccaagaattaa

DBGET integrated database retrieval system