KEGG   Drosophila virilis: Dvir_GJ21501Help
Entry
Dvir_GJ21501      CDS       T01066                                 

Gene name
Dvir_Try2
Definition
Trypsin-2
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dvi  Drosophila virilis
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:dvi04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 259 aa AA seqDB search
MANTSSIPNLALLVLCCAGGLAKPANQDYGRIVGGNDLVIHNAPWQVSIQVSARHVCGGA
IYSKEIIITAGHCVQGTSVTLLQVRVGANQHNSGGNLLPVAAYQIHEQYDGKLLHYDIAL
LRLASQLTFSLSVKAIALTSTSPPAGSSVSVSGWGHTEESGDAGFAQSLQLVQLQIIERG
DCASAKYGYGWDFVGTEMICAAAAGKDACAGDSGGPMVSDRLLAGIVAWGYGCAQPNYPG
VYVDVAILRSWIIKTANAI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggctaataccagctccattcccaatcttgcgttgctcgtgctttgctgcgctggcggc
ctggcaaagccggccaatcaggactatggtcgcattgtgggcggcaacgatttggtcata
cacaatgcaccctggcaggtgtccatacaagtgagcgcgcgtcatgtgtgcggcggcgct
atctacagcaaggagatcatcatcacagcgggtcattgtgtgcagggtacatccgtgacg
ttgctgcaggtgcgcgtgggcgccaatcagcacaattccggcggaaatctgttacctgtg
gcagcctaccagatccacgaacaatacgatggaaagctgctgcactacgacattgcgttg
ctgcgcctggcctcgcagctcacattcagtctgtccgtcaaggccattgcgctgaccagc
acgagtccaccagcgggcagcagtgtctccgtcagcggctggggccatacggaagagagt
ggcgacgctggctttgcccaaagcctgcagttggtgcagctgcagattattgagcgtggc
gactgcgcctctgccaagtacggctatggttgggattttgtcggcacggaaatgatatgc
gccgctgctgccggcaaggatgcctgcgccggcgattccggaggtcccatggtctccgat
cgtttgctggcgggcatcgtggcctggggctacggctgtgcgcagcccaattacccgggc
gtttatgtagatgtcgccatactgcgatcctggataattaaaacagcaaatgccatataa

DBGET integrated database retrieval system