KEGG   Drosophila virilis: Dvir_GJ21678Help
Entry
Dvir_GJ21678      CDS       T01066                                 

Definition
GJ21678 gene product from transcript GJ21678-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 152 aa AA seqDB search
MPKTLSILYLIIVLSTRTIQARQVNKCSLARQLYRYGVPYNELPDWLCLVEGESSFNTKA
INPSNVDGSVDWGLFQINDRYWCKPSDGRPSTDLCRLPCRLLLSNDIRYSIACAKYIRQQ
QGFSAWVAWNNRCQGAKPKVNRCFRRKHRYFG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaacgttgtcgattctgtatcttattatcgttctaagtacgagaacgatccaa
gctcgccaagtgaacaaatgtagcctggcgcggcagctttatcgctatggtgtgccctac
aacgagctgccggattggctctgcctggtcgagggtgagagctcgttcaacacaaaggct
attaatccatcgaatgtggatggctccgttgactggggactgtttcagattaacgatcgc
tactggtgcaagccatcggatggacgaccgtccacagatctgtgtcgcttaccgtgtcga
ctgttgctcagcaatgacataaggtattccattgcctgcgcaaaatatatcaggcagcag
caaggcttttccgcctgggtggcatggaataaccgctgtcaaggtgcgaagccaaaagta
aaccgttgttttagacgaaagcacaggtattttggctaa

DBGET integrated database retrieval system