KEGG   Drosophila virilis: Dvir_GJ21884Help
Entry
Dvir_GJ21884      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dvi  Drosophila virilis
Pathway
dvi04013  MAPK signaling pathway - fly
dvi04068  FoxO signaling pathway
dvi04137  Mitophagy - animal
dvi04140  Autophagy - animal
dvi04141  Protein processing in endoplasmic reticulum
dvi04214  Apoptosis - fly
dvi04215  Apoptosis - multiple species
dvi04310  Wnt signaling pathway
dvi04391  Hippo signaling pathway - fly
dvi04624  Toll and Imd signaling pathway
dvi04933  AGE-RAGE signaling pathway in diabetic complications
Module
dvi_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dvir_GJ21884
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ21884
   04310 Wnt signaling pathway
    Dvir_GJ21884
   04391 Hippo signaling pathway -fly
    Dvir_GJ21884
   04068 FoxO signaling pathway
    Dvir_GJ21884
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dvir_GJ21884
   04137 Mitophagy - animal
    Dvir_GJ21884
  Cell growth and death
   04214 Apoptosis - fly
    Dvir_GJ21884
   04215 Apoptosis - multiple species
    Dvir_GJ21884
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dvir_GJ21884
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dvir_GJ21884
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dvir_GJ21884
Protein kinases [BR:dvi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dvir_GJ21884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 6627383
NCBI-ProteinID: XP_002052403
FlyBase: FBgn0209001
UniProt: B4LR19
Position
Unknown
AA seq 369 aa AA seqDB search
MAAHHYTVEVGDTNFTILSRYIKLRPIGSGAQGIVCAAYDTITEQNVAIKKLSRPFQNVT
HAKRAYREFKLMKLVNHKNIIGLLNAFTPQHNLEEFQDVYLVMELMDANLCQVIQMDLDH
DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPY
VVTRYYRAPEVIFGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPS
PSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDSSQNSRRKASEARDLLSKMLVI
DPEQRISVDRALQHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYE
AHNTSNINR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcatcactataccgtcgaggttggcgatactaatttcacaattttgagtcgg
tacattaaattaaggcctataggatctggtgctcaaggcattgtttgtgctgcatatgac
acgattaccgagcaaaacgtcgctataaaaaagctatctcgtccattccaaaatgtgacg
catgccaagagagcttatagagaatttaaactaatgaaactggtgaaccataagaatatt
atcggtttgcttaatgccttcactccccaacacaatttggaagaatttcaggatgtttac
cttgtgatggagctaatggatgctaatttatgtcaagttattcaaatggatttagatcat
gatcgaatgtcttacttgctttaccaaatgctatgtggaataaagcatttacattccgct
ggaataatacatagagatttaaaaccttccaatatagttgttaaggccgactgcactcta
aaaattttggactttggacttgcgcgtacagctggaactacatttatgatgacaccttat
gtcgtaactagatactatagagctccggaagtcatttttggtatgggatataccgaaaac
gttgacatttggtcagtgggctgtatcatgggtgagatgataaggggtggagttctattt
cctggaactgatcatattgatcagtggaacaaaataattgagcaattgggtacaccgtcc
ccatcatttatgcagcgtctgcaaccaactgttcgtaattacgtggagaatcgtccaaga
tatacaggatattcgtttgataggctttttcctgatggtctgtttcctaatgacagtagt
caaaatagtcgaaggaaggcttctgaggcaagggaccttctcagtaagatgctggtaatt
gaccctgagcagagaatatcagtagacagagctttacagcatgaatacattaatgtatgg
tacgacgctgaagaagttgacgctcctgctccagagccatatgaccatagcgtcgatgag
agggagcatactgttgaacagtggaaggagcttatttatgaagaagtaatggactacgag
gcgcacaatacaagtaatattaaccgatag

DBGET integrated database retrieval system