KEGG   Drosophila virilis: Dvir_GJ21884Help
Entry
Dvir_GJ21884      CDS       T01066                                 

Definition
GJ21884 gene product from transcript GJ21884-RA
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
dvi  Drosophila virilis
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dvir_GJ21884
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dvir_GJ21884
   04391 Hippo signaling pathway -fly
    Dvir_GJ21884
   04068 FoxO signaling pathway
    Dvir_GJ21884
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dvir_GJ21884
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dvir_GJ21884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 369 aa AA seqDB search
MAAHHYTVEVGDTNFTILSRYIKLRPIGSGAQGIVCAAYDTITEQNVAIKKLSRPFQNVT
HAKRAYREFKLMKLVNHKNIIGLLNAFTPQHNLEEFQDVYLVMELMDANLCQVIQMDLDH
DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPY
VVTRYYRAPEVIFGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPS
PSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDSSQNSRRKASEARDLLSKMLVI
DPEQRISVDRALQHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYE
AHNTSNINR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcatcactataccgtcgaggttggcgatactaatttcacaattttgagtcgg
tacattaaattaaggcctataggatctggtgctcaaggcattgtttgtgctgcatatgac
acgattaccgagcaaaacgtcgctataaaaaagctatctcgtccattccaaaatgtgacg
catgccaagagagcttatagagaatttaaactaatgaaactggtgaaccataagaatatt
atcggtttgcttaatgccttcactccccaacacaatttggaagaatttcaggatgtttac
cttgtgatggagctaatggatgctaatttatgtcaagttattcaaatggatttagatcat
gatcgaatgtcttacttgctttaccaaatgctatgtggaataaagcatttacattccgct
ggaataatacatagagatttaaaaccttccaatatagttgttaaggccgactgcactcta
aaaattttggactttggacttgcgcgtacagctggaactacatttatgatgacaccttat
gtcgtaactagatactatagagctccggaagtcatttttggtatgggatataccgaaaac
gttgacatttggtcagtgggctgtatcatgggtgagatgataaggggtggagttctattt
cctggaactgatcatattgatcagtggaacaaaataattgagcaattgggtacaccgtcc
ccatcatttatgcagcgtctgcaaccaactgttcgtaattacgtggagaatcgtccaaga
tatacaggatattcgtttgataggctttttcctgatggtctgtttcctaatgacagtagt
caaaatagtcgaaggaaggcttctgaggcaagggaccttctcagtaagatgctggtaatt
gaccctgagcagagaatatcagtagacagagctttacagcatgaatacattaatgtatgg
tacgacgctgaagaagttgacgctcctgctccagagccatatgaccatagcgtcgatgag
agggagcatactgttgaacagtggaaggagcttatttatgaagaagtaatggactacgag
gcgcacaatacaagtaatattaaccgatag

DBGET integrated database retrieval system