KEGG   Drosophila virilis: Dvir_GJ21898Help
Entry
Dvir_GJ21898      CDS       T01066                                 

Definition
(RefSeq) GJ21898 gene product from transcript GJ21898-RC
  KO
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dvir_GJ21898
Chromosome [BR:dvi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dvir_GJ21898
   HAT complexes
    MOZ/MORF complex
     Dvir_GJ21898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2286 aa AA seqDB search
MRESAHDISMDTWKQWILEAISKIRSQKQRPSVQRICQAIGTHHKFHEDIVAEKLEKAVE
SGSVIKVYNKGLHSYKAPMAKRRIKVDKSTNLYKVVAKAVNDLGECEGSTIKNIENYIQK
FNCIELSPNVDFKTVIKISIKKAVDTGFLIQEGKLYKKGKSLTTPRKSVPETEILIKGEE
TCTHCSGNYQKNLNGIPEPLSSCKQCGISLHTTCANIAGKCKSQSYVLLYMLVTKGSIWN
CQKCADCVVCKLRNRGPCLLQCFACKNHFHLTCLDTIPDKKPKHPYRCKSCLNVDNPKSL
KRDTGSIKLEHGNDRIVPYSNVSQKPHSNCKRQMIKREERTDNPSTSQQSVNVVGQKQKK
KNCIVLTKVDSQIKQRKLYRDQIVNQRKRTYSDLSSTTTSSDSDDDDDDDDENNAACEDE
STSSDSCTSSSSESDSSDSSSDSSECDDDNDEEDYDTDRSTFKENIFENEKKIEFRSSPN
ETASLQDVSSENWGFAAVAKNPVDNKYIKNFKCMSYSNNATVNQTIDPIKATKYASNKSD
DVDMDGDLAPRRSHSNIGKKRTIILKSMPLECTKSYSKHDDDIPYLTKETVLRCQMINEK
EQFEEPRKKTLDERTDYLCMENEKDQTVKSTSRSKPFENQHLPPGVNHFDVNLYQEVLQK
AVLKVSTNHSEITTEKSNSLIHCGQSPKSIEMGKWNIETWYSSPFPQEYARLLKLYLCEF
CLKYTKSRSVLDRHQNKCIWKQPPGTEIFRQGDISVFEVDGNVNKIYCQNLCLLAKFFLD
HKTLYYDVEPFLFYILTKNDQVGCHLVGYFSKEKHCSQKYNVSCILTLPQYQRQGYGRFL
IDFSYLLSREEGQLGTPEKPLSDLGRLSYFSYWKSVVLEYLYKYRNNQTITFKDIAIKTG
LAVSDIALAFELLNFIKLRKNDGDIRFQINVKIDWKKVLLHYNKTAQSKTRIPIEADCLR
WSPLMTISKSPNFNIRPISNREYLSFQFIENSDDKYSYKKRTDENLKTPVASTNEFFEDL
NKDCEKPYKSPCENTDSISSYTKKSIYSDTSQLTLNDAKRCKRPFDDKRENSDSSDSKYS
KKSSESSEYNALTKRALRLAKRKDSIPHTNKRKHFERENNMDSVEHNIPNQNDQQNSKEG
LDKCSILQRAAVQESSRNIMKPVNIVPKLRGKKSNGKRDEETKAAGQSSSKITLGECDNA
QVIEVINEKHEVELSPQLMEKEKNSTEHSNEQVLDAVAKKTKKALFSDTTSFETKNDDNA
TAECKIELSVKADENIFNSQAECKIKDNFELKPDSIAVASSEINFEEKVINNSFTPENGS
KVLPVVEKTETKVPIVNDKCLENNEPIKQNSDEQSSKNGPTTTEPTKEPSVVVSASGSNS
SKALDGCVKKAKADKTDTKLSGSPEKIETSKTEPSPVKVLSSCSKQASSEIDKAPTNHEK
VSPGKPLESVMQETDVKQKINKKAVLESCIAKSENVNTLCKKTDAPNPNKTSISSEKDMN
KSTQLLQVKEEEKSNVRASTSSLPIRDKIQLKNNDHSQLQNPITSQFPINQMPNYHHTSQ
YWQWDYYSYNLCNLDPASQKGQKQFHKDLATTMAYTHNFTQNLYQSANLAMHAHHQMHHT
KDKQKVDRKVAGKKEDLSKQVSSNSSVNTLRDEGHTLNCNDYNVNQSNMFDQKCTNQQKL
FKTTADHTQQVKSIDNAQNTITRPTNSNQAESTILISSSLSRESSSSLPTKQKSEQSGNI
TLDPSREEKIKVTQPILQSVNHSNLQVGGQPGVNPNMAYTSESSSNVPIQHYDCGVNVQI
NMDSPAGIGGAVNHGSENTNGLMHRQFSDCSMQNQSATTPMHMSIQNSHMQQQNNINMNL
PPEGSPNLNIIGNSQHQHQNRKLTVQPDIVANSPSTSHREPTPKQIRNSNSSNNSQQRDA
KVPTGGTSQNSHHQHSQSTVSNISKAQQDGIGSLQFAQSSGQHGHQQNMQPLDYIPIPQI
TQNFSTNPSNYDIVGMPAVIQQRMSLNSSVHSLSNSHQRIEQPSSACAVNNFYLQNNMPS
NDIVSNTSRIPVATSLGPPSSVANNEQSISSNSGGTTSSLVGHLCSLSKLQQLTNCLESQ
PCNTSPGAQTNLTPSPHHPIPPNSMTPPPHLLMQNRNVSTPPNMLQTQVTPLQYKYYTSN
MNITPSTAAQNTNRNTRNTPSAPIQHSSAAISSSSNNRTANVHISPNLMSHYGAINSYRM
SPQQSPPTSAYSSGGEYANSQLPMQMGVMNMQSQYQDACVLQRATQPNPMYPTYSPYLPL
NSSIRR
NT seq 6861 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatctgctcatgacatcagtatggacacttggaaacaatggatacttgaagcg
atatcaaaaattcggtcacaaaaacaaagaccgagtgtccagagaatttgtcaggctatt
ggaacacatcacaaattccacgaagacattgtggctgaaaaattagaaaaggcagttgaa
tctggatcagttattaaagtatacaacaaaggcttgcattcatataaagcgccaatggcg
aaaagacgaataaaagttgataagagtacaaatctatacaaagtggtagctaaagcagtt
aacgatttgggagaatgtgagggatcgaccattaaaaatatagaaaattatattcaaaaa
tttaactgcattgaactttctcccaatgttgattttaaaactgtaattaaaatatcaata
aaaaaggccgttgatactggcttcctgatacaggaaggaaagttatacaaaaagggcaaa
tccctaacaacaccacgaaaatctgtaccagaaacagagatacttataaaaggagaagaa
acttgtacacattgctccggtaattatcaaaaaaatcttaatggcattcctgaaccactt
agctcctgcaaacaatgtggaatatcattacatacaacatgtgcaaatattgcgggaaaa
tgcaaatcccaatcttatgtgcttctctatatgcttgttactaaaggctctatatggaac
tgtcagaaatgtgccgattgcgttgtgtgcaaattacgcaatcgcggtccatgcctttta
cagtgttttgcttgtaaaaatcattttcatttgacctgcctcgatacgataccggacaaa
aagcccaagcatccatatcgatgcaaatcgtgtttaaacgttgataatccaaaatcatta
aagagggatacaggaagcattaaactagagcatggaaatgatagaattgtcccatattct
aatgtctcccaaaaaccacattccaattgcaaacgacagatgattaaaagggaagaacgc
acagataatccttcgacgtcacaacaatccgtaaatgttgtcggccagaaacaaaagaaa
aagaattgcatcgttcttacaaaagttgattctcaaataaagcaaagaaaactatatcgg
gatcagattgttaatcaacggaaacgtacatattcggatttatcatcaacaactacttca
agtgatagcgatgatgatgatgacgacgatgatgaaaataatgctgcgtgcgaagatgaa
agtacgtcttcagactcatgtacttcttctagctctgagtcagactcaagcgatagctcg
agtgatagttctgaatgcgatgacgataatgatgaagaagactatgacacagatagaagt
acatttaaagaaaatatatttgaaaacgaaaagaaaattgagtttcgatcttcaccaaat
gagaccgcaagtttacaagacgtatcctcggaaaattggggatttgctgctgttgcaaaa
aatccagttgataacaaatatataaagaattttaaatgcatgagctattcgaacaatgcc
acagttaatcaaaccatcgatcccattaaagctaccaaatatgcatctaataaatctgac
gatgttgacatggacggagatttggccccaaggcgaagccattcaaatattggaaagaaa
agaacaataatcttaaagtctatgcctcttgaatgtactaaatcatacagcaaacatgat
gatgatattccgtatctcacaaaagaaactgttttaagatgccaaatgattaatgaaaaa
gaacagtttgaagaaccacgcaagaaaacattagatgaaagaactgattatttatgtatg
gaaaatgaaaaggatcaaactgttaaatctacgagccgaagtaaaccgtttgaaaatcaa
catctaccgcctggcgttaatcattttgacgttaacttatatcaagaagtcctgcaaaaa
gctgttttgaaagtttctacaaaccattccgaaataactactgagaaaagcaactctctg
attcattgtggacaaagtcccaaatctattgaaatgggcaaatggaatattgaaacatgg
tactcgagtccatttccacaggagtacgcgaggcttttaaaactttatttatgtgaattt
tgccttaagtatacaaaaagtagatctgtattggatcgacatcaaaataaatgtatttgg
aaacaaccgcctggaactgaaatttttcgacaaggcgatatatctgtttttgaagtggat
ggcaatgtgaacaagatttactgtcagaacttatgcctgcttgcaaagtttttcttagat
cataaaactctttattatgatgtagaaccatttctattttatatattaaccaaaaatgat
caagttggctgtcatctggttggatatttttctaaagaaaagcattgctctcaaaagtat
aatgtatcgtgcattctgactctgcctcagtatcaaagacaaggttatggcagatttttg
atagacttcagttatttacttagccgagaagaaggtcagttgggaacgccagagaaacca
ctttctgatctcggtcgtctatcatacttttcatactggaaatcggttgtattagagtac
ttgtataagtacaggaataaccaaacaataacatttaaagatatagccataaaaactggc
ttagctgtttctgatattgcactggcatttgagctccttaacttcatcaaattaagaaaa
aacgatggcgacattagatttcaaatcaatgtgaaaatagattggaaaaaggttttgtta
cattataataaaacggctcagagcaaaacacgaataccaattgaagcagattgtctaaga
tggagtccgttaatgacaatttctaaatcgcccaattttaatatacgacctatatcaaat
cgcgaatatttaagttttcaatttattgaaaattcagatgataaatattcgtataaaaag
agaactgatgaaaacttaaagactccagtggcttcgactaatgagttttttgaagattta
aataaagattgtgagaaaccttataagtcgccttgtgaaaataccgatagtatttcaagt
tacactaaaaagagcatatactctgatacttcacaattaacactaaatgatgcaaaaagg
tgtaaacgtccttttgatgataaaagagaaaactcagactcttctgacagtaaatattct
aaaaagtcgtcagaatcatcagaatacaatgcgttgactaaacgagcgctacgtctggct
aagcgaaaagactcgattcctcataccaacaaaagaaagcattttgaacgtgaaaataat
atggatagtgtggaacataatattccaaaccaaaacgatcaacagaattctaaggaaggt
ttagacaaatgttctattttgcaaagagctgctgtccaagaatctagtcgaaatattatg
aagcctgtcaatattgttccaaaactgcgaggtaaaaaatcaaatggaaaacgggatgaa
gaaacgaaggctgccggtcaaagctccagtaaaattacattaggcgaatgtgataatgct
caagtgatcgaagtaataaacgaaaaacatgaagttgagcttagtccgcagttaatggaa
aaagaaaagaactccactgagcacagtaatgagcaagtcttagatgccgttgcaaagaaa
acgaagaaagcattgttttctgatacgacttcattcgagacaaaaaacgatgacaatgca
acagcggaatgtaaaattgagctaagtgtaaaagctgatgaaaatatatttaatagccaa
gcggaatgcaaaattaaagataatttcgaattaaaaccagactctattgcggttgcttct
tctgaaatcaattttgaagaaaaagttattaataattcatttactcctgaaaatggcagc
aaagttttaccagtagttgaaaaaactgaaactaaagtacctattgttaatgataaatgc
ttggaaaacaatgaacccataaaacagaactcggatgaacaaagttctaaaaatggtccc
actacaactgaacctactaaagaaccatccgtcgtggtgtcagcatcgggaagtaattct
tccaaagcccttgatggttgcgtcaaaaaagccaaagctgataaaactgatactaagctc
agtggctctcccgaaaaaattgaaactagcaaaactgaaccgtctccggtaaaggttttg
agtagttgcagtaaacaggcaagcagtgaaattgacaaagcacctacaaatcacgaaaaa
gtaagccctggaaaacctctggagtctgtaatgcaagaaactgatgttaaacagaaaata
aataaaaaagcagttctggaatcttgtattgcaaagtcggaaaatgtgaacaccttatgc
aaaaaaacagacgcgcctaatccaaataaaacaagtataagctcagaaaaggatatgaat
aaatcgacgcaattacttcaagttaaggaagaagaaaaatcaaacgtacgtgcctcgacg
tcttcattgcctatacgagataaaattcaacttaaaaacaacgaccattctcagttacaa
aatccaataacatctcagttcccaataaatcaaatgccaaactaccatcatacttctcaa
tattggcagtgggactattacagctataatctttgtaatttagacccagcatcgcaaaag
ggtcaaaaacagtttcataaagacctcgcaactactatggcatatacacataactttaca
caaaacctataccaatcggccaatttagcaatgcatgctcatcaccaaatgcaccataca
aaggataaacagaaggttgacaggaaagttgcaggaaaaaaagaagatttgtcaaaacaa
gtatcctccaacagctctgtcaatacattaagagatgaagggcatacacttaattgtaat
gattataatgttaaccaatcgaatatgtttgatcagaagtgcaccaatcaacaaaagttg
tttaaaacaactgccgatcacacacaacaagtaaaatccatagacaatgcgcagaacacg
ataaccagacctacgaattctaaccaagcagaatcaacaattttaatatcaagttcattg
agccgggaatcatcttcctcattgcccacaaaacaaaaatcagaacaaagcggtaacata
acattagatccttcgcgagaggagaaaattaaagtaacccaaccaatcttgcaatcagtt
aatcactcaaatttgcaagtcggcggtcaacctggtgtaaatccaaatatggcatacacc
tcagaatcatcatctaacgtgcccatacagcattatgactgtggagtaaatgtacaaata
aatatggactctcccgctggtattgggggtgctgttaatcatggatctgaaaacaccaat
ggacttatgcacagacagttttctgactgttcaatgcaaaatcagtcagcaacaacacct
atgcacatgtcaatccaaaattcacatatgcaacagcaaaacaatataaatatgaatttg
cctccagagggttctccaaacttgaatataataggaaattcacaacatcaacatcaaaat
aggaaactaactgtgcagccggatatcgttgcgaactccccgtcaacatcacatcgagaa
cctacacccaagcaaattcgcaatagcaattcgtcaaataattctcagcaacgtgatgct
aaagttccaacaggagggacttctcaaaattctcatcaccaacactctcaaagcacggtt
tcaaatatatctaaggctcaacaagatggaattggtagcttacagtttgcgcagtcaagt
ggacaacatggtcatcagcagaatatgcaacctttggattatatacctataccgcagatt
actcaaaacttttcgacaaacccatcaaattatgatatagttggaatgccagctgtgatt
caacagagaatgtcgctaaatagctcagttcattccctttcaaactctcaccaacgcatt
gaacaaccgtcatcagcttgtgctgtaaataatttctatttacaaaataacatgccatca
aatgacattgtatcaaacacatctcgtataccggtcgccacttctttagggcccccgtcg
tccgtagctaataatgaacagtccatatcatcaaacagcggtggcaccacatcatcttta
gttggacatttatgtagtctttcaaaacttcagcaacttaccaattgccttgaatctcag
ccgtgtaatacatccccaggagcgcaaacgaatttaacaccgtcgccacaccacccaatt
ccacccaattctatgacccctcctccacatttattaatgcaaaatagaaatgtttctacg
cctccaaatatgttgcaaacacaagtaacacctttacagtataaatattacactagcaac
atgaacataacgccgagtacagcagctcagaacactaatagaaatactcgaaacacgccg
tccgcccccatacaacactcttcagcggcaattagcagcagttcaaataatcgcacagcc
aatgtgcacatcagtccaaatcttatgtcacattatggggccatcaacagctacagaatg
tcgcctcagcagagtcctcccacatcagcttatagttcgggtggtgaatatgcaaattct
cagcttccaatgcaaatgggcgttatgaacatgcaatctcagtatcaagacgcatgcgta
ttgcagagagctactcaacctaatccgatgtatcccacatattcgccatacttgccgttg
aacagctcaatacgcagataa

DBGET integrated database retrieval system