KEGG   Drosophila virilis: Dvir_GJ22324Help
Entry
Dvir_GJ22324      CDS       T01066                                 

Definition
GJ22324 gene product from transcript GJ22324-RA
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dvir_GJ22324
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   Dvir_GJ22324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 317 aa AA seqDB search
MASAPQSKRQKLSEPQCVEDIVPLNYKELDIIGTGAYGTVYRARDNITGHFVAIKKVRIA
LTENGVSASTLREISLLKQLNTYDHANIVKLLDVCQFLERDGKLLILLVFEHLEQDLSDL
IEALPPSGMSPTNIQRLSRELLTGVDFLHAHRIIHRDLKPQNLLVSSQGHLKIADFGLAK
TYGRDMKLTSVVVTLWYRAPEVLLAQGYNSSVDIWSAACIIFEMFNRKPLFPGNSEKNQL
DRIFELTGRPTEEQWPKSVSISREHFPPRSRKRPSDFCPDLGKFADNLLDQMLSYQLHKR
PTALACLEHEYFQEEPL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgcaccgcaaagcaaaaggcaaaaactatccgagccgcaatgtgtggaggat
attgtaccgttaaattataaggaactggatattatcggcacaggcgcctacggcacagtt
tatcgggcacgcgacaatatcaccgggcacttcgtggccattaagaaggtgcgcattgca
ctcaccgagaatggagtgagtgcgtccacgctgcgagagatttcgctccttaagcagctg
aatacatatgatcatgcgaatattgtcaaactgctcgacgtatgccagttcttggaacgc
gatgggaaattgttgattctgttggttttcgagcacttggagcaggatttatccgactta
atagaagctttgccaccctccggcatgtcgcccacaaatatacagcgcctgtcgcgtgag
ctattgaccggagtggactttctgcacgcccatcgcatcattcaccgcgatttgaagccg
caaaatctgctcgtctcgtcgcagggccatctaaagatagccgattttggcctggccaag
acctatggccgggacatgaaactcacctcggtcgtggtcaccctgtggtatcgggcgccc
gaggtgctgctcgcccagggctacaacagctcggtggacatctggagtgcggcctgcatc
atattcgagatgttcaatcgcaagcccctctttccgggcaactccgagaagaatcaattg
gatcgcatattcgaactaacgggacgtcccacggaggagcaatggcccaagagcgtgtcc
atctcgcgggaacactttccgccacgcagtcgcaagcgaccctccgacttctgtccggat
ctcggcaaattcgccgacaatttgctggaccaaatgctctcgtatcagcttcacaagcgt
cccactgcgctggcctgcttggagcatgagtatttccaggaggagcccttgtag

DBGET integrated database retrieval system