KEGG   Drosophila virilis: Dvir_GJ22388Help
Entry
Dvir_GJ22388      CDS       T01066                                 

Definition
GJ22388 gene product from transcript GJ22388-RA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dvi  Drosophila virilis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dvir_GJ22388
   01230 Biosynthesis of amino acids
    Dvir_GJ22388
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvir_GJ22388
   00030 Pentose phosphate pathway
    Dvir_GJ22388
   00051 Fructose and mannose metabolism
    Dvir_GJ22388
   00052 Galactose metabolism
    Dvir_GJ22388
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dvir_GJ22388
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dvir_GJ22388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 788 aa AA seqDB search
MNSDINQRFLARGSQRDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGM
VDGGECIQEASWASVSSIIHRGGTIIGSARCQDFRERAGRLKAANNLIQRGITNLVVIGG
DGSLTGANLFRQEWSSLLDELSKNGTITSEQKEKYNVLHIVGLVGSIDNDFCGTDMTIGT
DTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLAISAAIATEADFMLIPEEPVAVN
WQDSLCQKLVQERKAGQRLNIVIVAEGAMDREGNPITAEDVRKVIDERLKHDARITVLGH
VQRGGNPSAFDRILACRMGAEATLALMEATEESVPVVISLDGNQTVRVPLMECVERTQAV
AKAMKERRWADAVKLRGRSFERNLETYKMLTRLKPPKECFDEQGKGIEGFRLAVMHIGAP
ACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRVLGWSDVSGWVGQGGAYLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQISDQRDNYPEFCIPIVVVPATISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYTTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLATQIKNNIDANGVVNCKSTDTATL
LGIVARQYRFSPLVDLIGETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECATDAVA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgatattaaccaacgtttcctggctcgcggctcgcagcgtgacaagggcctg
gccgtcttcaccagcggcggcgactcgcagggcatgaatgcggcagtgagagcctgtgtg
cgtatggccatctatttgggatgcaaggtctactttatccgggaaggctaccagggcatg
gtggatggtggtgaatgtatccaggaagcatcgtgggcatcggtctcgtcgattatacac
cgtggtggcacgatcattggctctgcccgttgccaggactttcgtgagcgcgcgggtcgc
ctgaaggccgccaacaacctgatacagcggggcattaccaatctggtggttattggcggc
gatggctccctgactggtgccaatctgtttcgtcaggagtggtccagcctgctggacgag
ctgtcgaagaatggcaccattactagcgagcaaaaggagaagtacaatgtgctgcacatc
gtcggcctggtgggatcgattgacaacgacttctgcggcacggacatgaccatcggcacg
gacaccgcactgcatcgcatcatcgaggcgatcgatgccatttccagcacggcctattcc
catcagcgcaccttcattatggaggtcatgggtcgtcattgcggctatttagcaatttca
gcagctatcgctacagaagctgattttatgttaatacccgaagagcccgttgccgttaac
tggcaggattctctatgccagaagctagttcaggaacgtaaggctggccaacgtctgaac
attgttattgttgcggagggtgccatggatcgcgaaggcaacccaattaccgctgaggat
gtgcgaaaggtgatcgatgagcgtctcaaacatgatgctcgcatcactgtgctgggccat
gtgcagcgtggcggcaaccccagcgccttcgatcgtatattggcctgtcgcatgggtgct
gaggccacactggccctgatggaggccacggaagaatcggtgccagttgtcatttccctg
gacggcaaccagacggttcgtgtcccactgatggagtgtgttgaacgcacccaggccgtg
gcaaaggccatgaaggagcgacgttgggcggatgccgttaagctacgaggacgctcgttt
gaacgcaatctggaaacgtacaagatgttgacccgcttgaagccacccaaggagtgtttc
gatgaacagggcaagggcattgagggcttcaggctggccgtaatgcacatcggtgcccca
gcctgcggcatgaatgcggccgtgcgcagttttgtgcgaaatgcgatttatcgcggcgac
gttgtctacggcatcaacgatggcgtcgagggtctcattgctggcaatgtacgcgtgctg
ggctggtctgatgtgtccggctgggtgggtcaaggtggtgcctatttgggcacaaagcgt
acgctgcccgagggcaaattcaaggagatcgctgcacgtcttaaggagttcaagatccag
ggtctgctcatcattggcggattcgagagctatcatgccgctggccaaatttccgatcag
cgtgacaattatccagaattttgcatacccattgtagttgttccggctaccatttcgaac
aatgtgcctggcactgaattctcgcttggctgcgacactggtctcaatgagataaccgaa
atctgcgatcgcattcgccaatcggcgcagggcacaaagcgacgcgtgtttgttattgag
acaatgggtggatattgtggctatctggccacgctggctggcttggctggtggcgccgat
gctgcctatatatacgaggagaagttctccatcaaggacttgcagcaggatgtctaccac
atggcatcaaaaatggccgaaggcgtctctcgcggtctgatcttgcgcaacgagaaggcc
agtgaaaactacaccacggacttcatctaccgcctgtattcggaggagggcaagggtctc
ttcacctgccgcatgaacatcttgggccacatgcaacagggtggctcgccgacacccttc
gatcgtaacatgggcaccaaaatggccgccaagtgtgtcgactggctggcaacccagatc
aagaacaacatcgatgccaatggcgtggtcaactgtaaatcgaccgatacggcaactctg
ctaggcatcgttgcccgtcaataccgcttcagtcccttggttgacctcattggcgagacc
aactttgatcaacgcataccgaagaaacagtggtggctgcgtttgcgtccacttttgcga
atcctcgccaagcatgactctgcctacgaggaggagggcatgtacattaccgtcgaggag
gagtgcgccacagatgcagtcgcttaa

DBGET integrated database retrieval system