KEGG   Drosophila virilis: Dvir_GJ22665Help
Entry
Dvir_GJ22665      CDS       T01066                                 

Definition
GJ22665 gene product from transcript GJ22665-RA
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dvir_GJ22665
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Dvir_GJ22665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 624 aa AA seqDB search
MTTPAPRHVRDLLAFGTDSEDEYSITPCKSQKTKNADQAGSRKLEAIPRRRAEMTMLDSD
SDDEDNKNNHNLNCAILNDSFVLSPTHELTGSTSTVPSTSAMALRPSDSNLSFLGRFGNM
DINCSNNTNKSPHLQVEQQQKHQQPIKKPPPSTLQIISEQRKAVDSETPMRATSAASLKS
HAKPETEFVTPQVCSIATRHGTRTQTTQKTRIELANEFRSQKVLFQTPMTVSRAAPFTSD
SLTFSLCDTISESPDTPAQPRPKAEAPTANKSKKSLDGAFRHAEQAKSELGSSAAVAVPV
SASVSAPVTAAAVPDKPDTSSKSNSNVLQIKNHEYVIVKKLGCGGSSSVYLARRKDTGQE
FALKVVDLQADPVVVQGYLNETKLLEKLQGNVCVVSLYDYQLLRQESKLYMVMEKGDCDL
NKILQGFTTNLPLYNLMNILYQMLQAVNYIHQNGVIHSDLKPANFLMVNGRLKLIDFGIA
SNISVDSTSIIKFSQAGTFNYISPEALTDISSGTSPMRGSNQPKIKISTKSDVWSLGCIL
YLLLYQKTPFGHIRNINAKMSAIANPSSSIEYPAIPIYYPLMLVHMVKHCLQLNPKKRPS
CVELLQYPFHMVIPLQNLQLASKR
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgactacacctgcaccacgccatgttagagatttgttggcatttggtacagattcagaa
gatgaatacagcattacaccctgcaagtcgcaaaaaacaaagaacgcggatcaagctggt
agccggaaactggaagcaatccccagaagacgtgcagagatgacaatgctggactcggac
agtgatgatgaggataataagaacaatcacaatttgaactgcgccattctaaacgattcc
tttgtgctgagtcctacacatgagctgactggcagcacctcaactgtaccttccacatcg
gcgatggcactgcgccccagtgattccaatttgtcgtttcttggccgtttcgggaacatg
gacatcaattgcagcaacaacaccaacaagtcacctcatctgcaagtggaacagcaacaa
aaacatcaacaaccgatcaaaaaaccaccgccctccacgctgcaaataatttcagagcaa
cgcaaggccgtggatagcgaaacgccaatgcgtgcaacttcagcggcctctttgaaatcc
catgccaagcccgagacggaatttgtaacgccgcaggtgtgcagcattgccacaaggcat
ggcacgcgcacacaaactactcaaaaaactcgcatcgaactggcaaatgagtttcgttcg
cagaaggtgcttttccagacgcccatgactgtgagtcgcgcggcgccctttacaagcgac
agtcttacgttttcgctatgcgacacaataagcgagagtccggatacgcccgctcagcca
cggccaaaggcagaagcgcccaccgccaacaaatcaaaaaagtcacttgatggtgcattt
cgtcatgctgagcaggcgaagtctgaattgggctcgtcagctgcagttgcagtacccgtg
tccgcgtccgtgtccgcacctgtgactgctgctgcagtacctgacaaaccagatacatca
tcgaaatcgaattccaatgtgctgcaaatcaagaaccatgagtatgtcatagttaaaaaa
ctgggctgtggcggctcaagttctgtttatctagcacgtcgcaaggatacgggccaggag
tttgctcttaaagtggtagatctgcaagccgatccggttgtggtgcagggctatctcaac
gaaaccaaactgctcgagaagctccagggcaatgtgtgcgttgtttccctctatgactat
caactgttgcggcaagaatcgaaactctacatggtgatggagaagggcgactgtgacttg
aacaagatcttgcaaggatttacgacaaacctgccactatataatctgatgaacatactc
taccaaatgctgcaggcagtcaattatatacaccagaacggtgtgattcattcggatctg
aaacctgctaattttctgatggttaatggtcggctgaagctaatcgattttggcattgca
agcaacatttcggtggactcgacaagcattattaaattctcacaggcgggcacattcaac
tacatcagtccggaagcacttaccgacatttccagcggcacaagtccgatgcgcggcagc
aatcagcccaagataaagatttcgacaaagtcggatgtttggtcgctcggctgcattttg
tatttgctgctgtatcagaagacaccattcgggcacattaggaacatcaatgccaagatg
agcgcgattgccaatcccagctccagcatcgagtatccggctataccaatttactatccg
ctgatgctagtgcatatggtcaagcattgtctacagctgaatccgaagaagcggccctcg
tgcgtagaactacttcagtatccattccatatggtaatacccttacagaatctacaattg
gcgtccaagcgctga

DBGET integrated database retrieval system