KEGG   Drosophila virilis: Dvir_GJ22760Help
Entry
Dvir_GJ22760      CDS       T01066                                 

Definition
GJ22760 gene product from transcript GJ22760-RA
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dvi04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 418 aa AA seqDB search
MSKAVNNMNMAIVEPQERMKYLSHCGNLIDVDKNMPVTRYYRAGTEMLRMANVYLNEGNH
ENAFILYMRYMTLFIEKIRQHPDYASVKAEVKAINKTIKDEIMPTTEKLRTKLLGQYQRE
YEQFLANKEAERMREQERERQQQLANKKAAAAGTVPSLIPANLHVQIDPSNQPTAPDLGL
LDQVVYPNDFPTGTNRNHLPNSGLLLPAVADAGADRTANSSSKPGFDRSRKPQYNRTDSL
LAGSLRTVNVPGDTMEVFLKLARANTSNNIETCGVLAGHLAHNQLYITHIITPQQHGTPD
SCNTMHEEEIFDVQDQMQLITLGWIHTHPSQTAFLSSVDLHTHCSYQMMMPEAIAIVCAP
KYNTTGFFILTPHYGLDYIAQCRQTGFHPHPNDPPLFMDAQHIKMDDQAKIKVIDLRR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggcggtgaacaacatgaacatggccattgtggagccgcaggagcgcatgaaa
tacctgtcccactgcggcaatctcatcgatgtagacaaaaatatgcccgtgacgcgctac
taccgcgccggaacggagatgctgcgcatggccaacgtctatttgaatgagggcaaccat
gagaacgcgtttatactctacatgcgctacatgacgctcttcatagagaagatacgccag
catcccgactatgccagcgttaaggccgaggtgaaggccatcaataagacgattaaagac
gagatcatgcccacaacggaaaagctgcgcaccaagctgctgggccagtatcagcgtgag
tatgagcagtttctggccaacaaggaggcggaacgtatgcgcgaacaggaacgtgagcgc
cagcaacagctggccaacaagaaagcagcggcagcgggcactgttccttcgctcataccc
gccaatttgcatgtgcaaatagatccgagcaaccagccaactgcaccagatctgggtcta
ctggaccaggtggtctatccaaacgattttcccacgggtaccaatcgcaaccacttgccc
aattctggtctgctgctgcccgcggtagctgatgctggagcggacaggacagccaactcg
tcctcgaaacctggctttgatcgcagccggaagccgcaatataatcgcactgattcgctg
ctggcgggctcgctgcgcaccgtcaatgtacctggggataccatggaagtgttcttgaag
ctggcgcgtgccaatacctccaacaacattgagacttgtggcgtgctcgctggccatctg
gcgcataaccagctctatataacgcatattattacgccgcagcagcatggcacgcccgac
agctgcaacacgatgcacgaggaggagatctttgatgtccaggatcaaatgcagctcatt
acgctcggctggatacatacccatcccagccaaactgcatttttgtcctccgttgacttg
cacacgcactgctcctaccagatgatgatgcccgaggcaatcgccatcgtctgtgcgccc
aagtacaatacaactggtttctttatactcacgcctcattatggtctggactacattgca
cagtgccggcaaaccggctttcatccccatcccaatgatccgccgttgttcatggatgca
cagcacatcaaaatggatgaccaggccaagatcaaagtcatcgatctgcgcagatag

DBGET integrated database retrieval system