KEGG   Drosophila virilis: Dvir_GJ22760Help
Entry
Dvir_GJ22760      CDS       T01066                                 

Definition
GJ22760 gene product from transcript GJ22760-RA
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dvir_GJ22760
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dvir_GJ22760
Peptidases [BR:dvi01002]
 Metallo Peptidases
  Family M67
   Dvir_GJ22760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 418 aa AA seqDB search
MSKAVNNMNMAIVEPQERMKYLSHCGNLIDVDKNMPVTRYYRAGTEMLRMANVYLNEGNH
ENAFILYMRYMTLFIEKIRQHPDYASVKAEVKAINKTIKDEIMPTTEKLRTKLLGQYQRE
YEQFLANKEAERMREQERERQQQLANKKAAAAGTVPSLIPANLHVQIDPSNQPTAPDLGL
LDQVVYPNDFPTGTNRNHLPNSGLLLPAVADAGADRTANSSSKPGFDRSRKPQYNRTDSL
LAGSLRTVNVPGDTMEVFLKLARANTSNNIETCGVLAGHLAHNQLYITHIITPQQHGTPD
SCNTMHEEEIFDVQDQMQLITLGWIHTHPSQTAFLSSVDLHTHCSYQMMMPEAIAIVCAP
KYNTTGFFILTPHYGLDYIAQCRQTGFHPHPNDPPLFMDAQHIKMDDQAKIKVIDLRR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggcggtgaacaacatgaacatggccattgtggagccgcaggagcgcatgaaa
tacctgtcccactgcggcaatctcatcgatgtagacaaaaatatgcccgtgacgcgctac
taccgcgccggaacggagatgctgcgcatggccaacgtctatttgaatgagggcaaccat
gagaacgcgtttatactctacatgcgctacatgacgctcttcatagagaagatacgccag
catcccgactatgccagcgttaaggccgaggtgaaggccatcaataagacgattaaagac
gagatcatgcccacaacggaaaagctgcgcaccaagctgctgggccagtatcagcgtgag
tatgagcagtttctggccaacaaggaggcggaacgtatgcgcgaacaggaacgtgagcgc
cagcaacagctggccaacaagaaagcagcggcagcgggcactgttccttcgctcataccc
gccaatttgcatgtgcaaatagatccgagcaaccagccaactgcaccagatctgggtcta
ctggaccaggtggtctatccaaacgattttcccacgggtaccaatcgcaaccacttgccc
aattctggtctgctgctgcccgcggtagctgatgctggagcggacaggacagccaactcg
tcctcgaaacctggctttgatcgcagccggaagccgcaatataatcgcactgattcgctg
ctggcgggctcgctgcgcaccgtcaatgtacctggggataccatggaagtgttcttgaag
ctggcgcgtgccaatacctccaacaacattgagacttgtggcgtgctcgctggccatctg
gcgcataaccagctctatataacgcatattattacgccgcagcagcatggcacgcccgac
agctgcaacacgatgcacgaggaggagatctttgatgtccaggatcaaatgcagctcatt
acgctcggctggatacatacccatcccagccaaactgcatttttgtcctccgttgacttg
cacacgcactgctcctaccagatgatgatgcccgaggcaatcgccatcgtctgtgcgccc
aagtacaatacaactggtttctttatactcacgcctcattatggtctggactacattgca
cagtgccggcaaaccggctttcatccccatcccaatgatccgccgttgttcatggatgca
cagcacatcaaaatggatgaccaggccaagatcaaagtcatcgatctgcgcagatag

DBGET integrated database retrieval system