KEGG   Drosophila virilis: Dvir_GJ22784Help
Entry
Dvir_GJ22784      CDS       T01066                                 

Definition
GJ22784 gene product from transcript GJ22784-RA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dvi  Drosophila virilis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dvi00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dvi00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dvi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 565 aa AA seqDB search
MFRCKNCLLLGALLLLLIAAIGGQAETVPCKLKDAQYGKVCVCTADYCDYLENPTLSQDD
EFALISSSKQGLRFELNKGSFGAQEKYTINDYEEPAAEMTASNGTILSRMVDQALASIFS
QPVTPTSSITRSVTLKVDRSKRYQRMEGFGGSFTGAVSYLLENYKEQDIQDHLYKSFYAA
KGLGFNLMRVAMGGCDFDLEAWSYNEQPENETILTGMEKLDDRDVIRVEQIKRLKAVSGV
ENLRIKGAAWSAPPWMKTNNRWTGFGRLKREYYQTWADYHLKWVELMENNGLPIWAISTG
NEPTNGILFMVFVKFMSMGWTPQTQAVWVDDNLGPTIRNSKYKDLVIFSNDDQRYTSPLW
FKQMNRTRPGSLKYIDGVSLHWYWDEIFGSSFVQDTNEFMANKIQIISESCIGDKPWQKA
APLLGSWERAEKVARSFLSHLQDGFHGWIDWNIILNEAGGPNYVNNTVDAPVIANTTSYT
EFYKQPMFYIMGHFSKLVPEGSVHIEAVASNVNLDCVAFMRPDEKIVAVLFNSGRADLDI
SVVDTVRGNLKVNVPAKSIHTLFYN
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggtgcaaaaattgcttgctccttggcgctttgctattgctgctgatagccgca
atcggtggccaggctgaaaccgttccatgcaagctcaaagatgcccaatatggcaaggtg
tgtgtttgcacggcggattactgtgactatctggagaatcctactctgagtcaggatgat
gaattcgcgctgatctccagcagcaagcaagggcttcgctttgaactcaacaagggcagc
tttggagctcaagaaaagtacaccataaatgactacgaagagccagctgcagaaatgacg
gccagcaatggcacaatcctatcacggatggtggatcaggcattagccagcatattctcg
caacctgtcaccccgaccagcagcatcactcgctccgtcacgctaaaggtggatcgcagc
aagcggtatcaaagaatggaaggtttcggtggcagcttcacgggagctgtgtcctattta
ttggaaaactataaggagcaggacattcaagatcatctgtacaagagtttctatgccgcc
aagggcttgggattcaatttaatgcgcgttgcaatgggcggctgcgattttgatttggaa
gcctggtcctataacgagcagcccgaaaacgaaactatactgaccggcatggagaagcta
gatgatcgtgatgttattcgcgtcgagcaaatcaaacgactgaaggcagtgtcgggcgtc
gaaaatctgcgaatcaaaggagctgcctggagtgcgccaccatggatgaagactaacaat
aggtggactggcttcggccgcctaaagcgcgaatactatcagacctgggctgactatcat
ctcaagtgggtggaactgatggagaacaatggtctgccgatttgggccatttccactgga
aatgagccaacaaacggaatactcttcatggttttcgtcaagtttatgagcatgggctgg
acaccacagacgcaagccgtctgggtggacgacaatttgggtcccacaattcgtaactcc
aagtacaaggacctagtcatattcagcaacgatgatcagcgatacaccagtccactttgg
ttcaaacagatgaaccgcacacgaccaggttcactcaaatacattgacggtgtatctttg
cactggtattgggatgaaatatttggtagcagctttgttcaagacaccaacgagtttatg
gccaataaaatacagatcatatctgagtcttgtattggcgacaagccttggcaaaaggca
gcccctctgttgggcagttgggagcgggcagagaaggttgcacgctcatttctgtcccat
ctgcaggatggcttccatggctggatagactggaatatcattttgaatgaggcgggtgga
ccaaactacgtaaacaacaccgttgacgctccagttattgccaatacgacatcctatact
gagttctacaagcagcccatgttctatatcatgggtcatttctccaagcttgtgcctgag
ggctccgtacacatcgaggcggtggccagcaatgtcaacctggattgtgtggccttcatg
cgacctgacgagaagattgtcgctgtcctcttcaacagtggacgcgccgacctggatatc
agtgtcgtggacactgtgcgcggaaaccttaaagtcaatgtgcccgccaagtctatacac
actttattctacaactaa

DBGET integrated database retrieval system