KEGG   Drosophila virilis: Dvir_GJ22784Help
Entry
Dvir_GJ22784      CDS       T01066                                 

Definition
GJ22784 gene product from transcript GJ22784-RA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dvi  Drosophila virilis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dvir_GJ22784
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dvir_GJ22784
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dvir_GJ22784
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dvir_GJ22784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 565 aa AA seqDB search
MFRCKNCLLLGALLLLLIAAIGGQAETVPCKLKDAQYGKVCVCTADYCDYLENPTLSQDD
EFALISSSKQGLRFELNKGSFGAQEKYTINDYEEPAAEMTASNGTILSRMVDQALASIFS
QPVTPTSSITRSVTLKVDRSKRYQRMEGFGGSFTGAVSYLLENYKEQDIQDHLYKSFYAA
KGLGFNLMRVAMGGCDFDLEAWSYNEQPENETILTGMEKLDDRDVIRVEQIKRLKAVSGV
ENLRIKGAAWSAPPWMKTNNRWTGFGRLKREYYQTWADYHLKWVELMENNGLPIWAISTG
NEPTNGILFMVFVKFMSMGWTPQTQAVWVDDNLGPTIRNSKYKDLVIFSNDDQRYTSPLW
FKQMNRTRPGSLKYIDGVSLHWYWDEIFGSSFVQDTNEFMANKIQIISESCIGDKPWQKA
APLLGSWERAEKVARSFLSHLQDGFHGWIDWNIILNEAGGPNYVNNTVDAPVIANTTSYT
EFYKQPMFYIMGHFSKLVPEGSVHIEAVASNVNLDCVAFMRPDEKIVAVLFNSGRADLDI
SVVDTVRGNLKVNVPAKSIHTLFYN
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggtgcaaaaattgcttgctccttggcgctttgctattgctgctgatagccgca
atcggtggccaggctgaaaccgttccatgcaagctcaaagatgcccaatatggcaaggtg
tgtgtttgcacggcggattactgtgactatctggagaatcctactctgagtcaggatgat
gaattcgcgctgatctccagcagcaagcaagggcttcgctttgaactcaacaagggcagc
tttggagctcaagaaaagtacaccataaatgactacgaagagccagctgcagaaatgacg
gccagcaatggcacaatcctatcacggatggtggatcaggcattagccagcatattctcg
caacctgtcaccccgaccagcagcatcactcgctccgtcacgctaaaggtggatcgcagc
aagcggtatcaaagaatggaaggtttcggtggcagcttcacgggagctgtgtcctattta
ttggaaaactataaggagcaggacattcaagatcatctgtacaagagtttctatgccgcc
aagggcttgggattcaatttaatgcgcgttgcaatgggcggctgcgattttgatttggaa
gcctggtcctataacgagcagcccgaaaacgaaactatactgaccggcatggagaagcta
gatgatcgtgatgttattcgcgtcgagcaaatcaaacgactgaaggcagtgtcgggcgtc
gaaaatctgcgaatcaaaggagctgcctggagtgcgccaccatggatgaagactaacaat
aggtggactggcttcggccgcctaaagcgcgaatactatcagacctgggctgactatcat
ctcaagtgggtggaactgatggagaacaatggtctgccgatttgggccatttccactgga
aatgagccaacaaacggaatactcttcatggttttcgtcaagtttatgagcatgggctgg
acaccacagacgcaagccgtctgggtggacgacaatttgggtcccacaattcgtaactcc
aagtacaaggacctagtcatattcagcaacgatgatcagcgatacaccagtccactttgg
ttcaaacagatgaaccgcacacgaccaggttcactcaaatacattgacggtgtatctttg
cactggtattgggatgaaatatttggtagcagctttgttcaagacaccaacgagtttatg
gccaataaaatacagatcatatctgagtcttgtattggcgacaagccttggcaaaaggca
gcccctctgttgggcagttgggagcgggcagagaaggttgcacgctcatttctgtcccat
ctgcaggatggcttccatggctggatagactggaatatcattttgaatgaggcgggtgga
ccaaactacgtaaacaacaccgttgacgctccagttattgccaatacgacatcctatact
gagttctacaagcagcccatgttctatatcatgggtcatttctccaagcttgtgcctgag
ggctccgtacacatcgaggcggtggccagcaatgtcaacctggattgtgtggccttcatg
cgacctgacgagaagattgtcgctgtcctcttcaacagtggacgcgccgacctggatatc
agtgtcgtggacactgtgcgcggaaaccttaaagtcaatgtgcccgccaagtctatacac
actttattctacaactaa

DBGET integrated database retrieval system