KEGG   Drosophila virilis: Dvir_GJ22807Help
Entry
Dvir_GJ22807      CDS       T01066                                 

Definition
(RefSeq) GJ22807 gene product from transcript GJ22807-RA (EC:2.1.1.43)
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
dvi  Drosophila virilis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dvir_GJ22807
Enzymes [BR:dvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dvir_GJ22807
Chromosome [BR:dvi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dvir_GJ22807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 694 aa AA seqDB search
MIMVRRRARPAKEPALMVVTSNGVDANSDATLALPFNGEPISAVAATATNNLLDDQYFAS
PKRKDCRLMKTHENLNAAEDSQCHSKDNNNKANGNSTKSETGRTIGVQLATRSQTRTIEN
FFKANAAAKSQQISTILSDTVIATTTTAEQKTITISGALDDELEEEESLLYDAHSIASPS
TSTSSPSYPNDDLETDNSSELGSNYTSIDTATHIQVDIHTQTDPHIDTSTNTAAFQTHRS
TLRDSHSSSHSSSSSSAATSDNIFLQEPVLTLDIDRTPTKASSIRINKSFELASAVFSSP
PSVLSACVLNGRFNQIVTLNGHGQGEEQEHEQEQHQLQQPLSGFELDQNDSSSCDSGVAC
CLTAGTSPAVAGNRRRKPATPHRILCPSPIKTMPRDTVLLKGDALSPRKSPRKLQMQLAA
SNACKSRRRLNQPKPQAPYQQPSPAPSEDVVLVDDGEDDDDDVHALLKAAEERENMNKAK
AMPKPATVAAAAVKPKASTKPAKARTMAAKSQPLAATNGNRELTEFFPVRRSVRKTKTAV
KEEMMRNLEQAVLEERCEGLQVRHFMGKGRGVVAVRRFKRNEFVVEYVGDLIAISEATER
ERRYALDENAGCYMYYFKHKNQQYCIDATIDTGKLGRLINHSRNGNLMTKVVVIKQRPHL
VLLAKDDIEPGEELTYDYGDRSKESLLHHPWLAF
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgataatggttcgcagacgcgcacggcccgccaaagagcccgccttaatggtggttacc
tctaacggggtcgacgcaaacagcgacgcgacgttggctctgccgtttaatggcgaacca
atcagcgccgtggctgcgacggccaccaataatctgctggatgatcaatactttgccagc
cccaagcgaaaagactgccgtcttatgaaaacgcatgaaaatctcaatgcggcggaagat
tcacaatgtcacagcaaagacaacaacaacaaggctaatggcaattcaaccaagtctgaa
actggccgcacaattggtgttcaattggcaacgcgttcgcaaacacgcaccattgagaac
ttctttaaagcgaatgcggctgcaaaaagccaacaaatatctactattctatcagataca
gtaatagctacaactacaacagcagagcaaaagacaataacaataagtggcgccttagat
gacgaattggaggaagaggaatctctcctgtatgacgcacactccatagcgtcgccttcc
accagtaccagctctccatcttatccaaacgatgatctggaaactgacaacagctccgag
ctgggcagtaactacacatctatagacacagctacacacatacaagtagacattcacaca
caaaccgacccacacatagacacatctacaaacacggctgcctttcagacgcatcgctca
acgctgcgcgacagtcacagctcgtcgcatagcagcagcagcagcagcgctgcgacttcc
gataatatatttctgcaggagccagtgctgacgttggacatcgatcgcacgcccacaaag
gcctctagcattcgcattaacaaaagctttgagctggcaagtgccgtattctcatcaccg
ccttctgtgctgagtgcttgcgtgctaaacggtcgcttcaatcagattgttacgctcaat
ggccatgggcagggggaggagcaagagcatgaacaagaacagcaccagctgcagcaaccg
ctgagcggttttgaattggaccaaaatgacagcagttcctgcgacagtggcgtcgcctgt
tgcttgacggctggcacatcgcctgcggtggcgggcaatcgacgacgtaagcccgcgact
ccacaccgcatactatgcccctcgcctatcaagacgatgccgcgcgacacagtgctgctg
aagggcgatgcgttgtcgcctcgcaagtcgccgcgtaaactgcaaatgcagctggccgca
agcaacgcgtgcaagtcgcgacgaagactgaatcagccaaagccacaagcgccttaccag
cagcccagcccagcgccaagtgaagatgtcgtattggtggacgacggtgaagacgatgac
gatgatgtgcatgcgttactcaaggctgcagaggagcgtgaaaatatgaacaaagccaag
gcaatgcccaaaccggctacagtagcagcagcagcggtcaagccaaaggcatctaccaaa
ccggccaaggccaggacaatggcggccaaatcccaaccactggccgcaacaaatggcaat
cgtgagctgaccgaatttttcccggtgcggcgcagcgttcgcaaaactaaaacggccgtc
aaagaggaaatgatgcgtaatctggagcaggccgtgctcgaggagcgctgcgagggtctg
caggttcgccactttatgggcaaggggcggggcgttgtcgcagtacgtcggttcaagcgt
aacgagtttgtcgtcgaatatgtgggtgatctcattgcgatcagcgaggccactgaacgc
gaacgtcgttatgcgctggacgagaatgccggctgctatatgtactactttaagcataag
aaccaacagtactgcatcgatgccaccattgacaccggcaagttgggtcgccttatcaat
cactcccgcaacggcaatttgatgaccaaagtggttgtcatcaagcaacgaccacatttg
gtgctgctagccaaggatgacattgagcccggcgaggagttaacatatgactatggcgat
cgttccaaggaatcgctgctccatcatccatggctggcattctga

DBGET integrated database retrieval system