KEGG   Drosophila virilis: Dvir_GJ22991Help
Entry
Dvir_GJ22991      CDS       T01066                                 

Definition
GJ22991 gene product from transcript GJ22991-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dvi  Drosophila virilis
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dvir_GJ22991
   04340 Hedgehog signaling pathway
    Dvir_GJ22991
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dvir_GJ22991
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dvir_GJ22991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 354 aa AA seqDB search
MSSQHLRTTFNSKEDYTTILDSLKQEFEQRWQAQEPSPYTNLESYVQRAVLGNGSFGTVL
LVREKKGKNYYAAKMMNKEDLVRLKQVNHVHNEKTVLNSVRFPFLVHLIDATKDFDYLYL
VLPFINGGELFTYHRKVRKFNEKQSRFYGVQVLLALEYLHHMSLMYRDLKPENILMDARG
YIKVTDFGFTKRVDNRTSTLCGTPEYLAPEIIQLKPYSKSVDWWAFGVLLFEFVAGHSPF
SMHNRDVILMYSKICLAEYRAPSFFTGQLKNLIDNLLQVDPSKRLGNSTEGSADIKTHPW
FQGVDWFAVLNQEISPPYIPTVSNIEDLSNFENFEAKSKFKSKINRHPELFNNF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccagcacctgcggacaactttcaattcaaaggaggactacaccaccattctc
gacagcctcaagcaggagtttgagcagcgctggcaagcccaagaaccgtcgccctacacc
aacctagagagctatgtgcagcgcgccgttcttggcaatggcagctttggcactgtattg
ctagtcagggagaagaagggcaagaattattatgcagctaagatgatgaataaggaggac
ctggtgcgactaaaacaggtcaatcacgttcacaatgagaagaccgtattgaactctgta
cgatttccatttctggtccatctaattgatgccaccaaggactttgattatctgtatctg
gtgttgccgtttatcaatggcggcgagttgttcacctaccatcgcaaagtgcggaagttt
aatgagaagcagtcccgcttctatggggtccaggtgctgctagccctcgagtacttgcat
catatgagtctcatgtatcgagaccttaagccagagaatattctaatggatgctcgtggc
tatatcaaagtgacagatttcggctttaccaagcgcgtggacaaccgcacctcgacgctt
tgtggcactccagagtatttggcgccagaaattattcaattgaagccgtatagtaagtcc
gtcgattggtgggcatttggtgtattactttttgagttcgtggctggtcattcgccattt
tctatgcacaatcgggacgttatattgatgtattcgaaaatatgtttagctgagtatcgt
gcaccctcgttctttacgggccaactaaagaatctgattgacaatctactgcaggtggat
ccctccaagcgtttaggtaactcaaccgaaggttctgcggatatcaaaactcacccatgg
tttcaaggcgtcgattggtttgcagtcctcaatcaggaaattagtccgccctatataccg
accgtgtctaatattgaagatttgtcaaattttgaaaattttgaagctaaatcaaaattt
aagtcaaaaataaatcgccatcccgagttgtttaataatttttaa

DBGET integrated database retrieval system