KEGG   Drosophila virilis: Dvir_GJ22991Help
Entry
Dvir_GJ22991      CDS       T01066                                 

Definition
(RefSeq) GJ22991 gene product from transcript GJ22991-RA (EC:2.7.11.-)
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 354 aa AA seqDB search
MSSQHLRTTFNSKEDYTTILDSLKQEFEQRWQAQEPSPYTNLESYVQRAVLGNGSFGTVL
LVREKKGKNYYAAKMMNKEDLVRLKQVNHVHNEKTVLNSVRFPFLVHLIDATKDFDYLYL
VLPFINGGELFTYHRKVRKFNEKQSRFYGVQVLLALEYLHHMSLMYRDLKPENILMDARG
YIKVTDFGFTKRVDNRTSTLCGTPEYLAPEIIQLKPYSKSVDWWAFGVLLFEFVAGHSPF
SMHNRDVILMYSKICLAEYRAPSFFTGQLKNLIDNLLQVDPSKRLGNSTEGSADIKTHPW
FQGVDWFAVLNQEISPPYIPTVSNIEDLSNFENFEAKSKFKSKINRHPELFNNF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccagcacctgcggacaactttcaattcaaaggaggactacaccaccattctc
gacagcctcaagcaggagtttgagcagcgctggcaagcccaagaaccgtcgccctacacc
aacctagagagctatgtgcagcgcgccgttcttggcaatggcagctttggcactgtattg
ctagtcagggagaagaagggcaagaattattatgcagctaagatgatgaataaggaggac
ctggtgcgactaaaacaggtcaatcacgttcacaatgagaagaccgtattgaactctgta
cgatttccatttctggtccatctaattgatgccaccaaggactttgattatctgtatctg
gtgttgccgtttatcaatggcggcgagttgttcacctaccatcgcaaagtgcggaagttt
aatgagaagcagtcccgcttctatggggtccaggtgctgctagccctcgagtacttgcat
catatgagtctcatgtatcgagaccttaagccagagaatattctaatggatgctcgtggc
tatatcaaagtgacagatttcggctttaccaagcgcgtggacaaccgcacctcgacgctt
tgtggcactccagagtatttggcgccagaaattattcaattgaagccgtatagtaagtcc
gtcgattggtgggcatttggtgtattactttttgagttcgtggctggtcattcgccattt
tctatgcacaatcgggacgttatattgatgtattcgaaaatatgtttagctgagtatcgt
gcaccctcgttctttacgggccaactaaagaatctgattgacaatctactgcaggtggat
ccctccaagcgtttaggtaactcaaccgaaggttctgcggatatcaaaactcacccatgg
tttcaaggcgtcgattggtttgcagtcctcaatcaggaaattagtccgccctatataccg
accgtgtctaatattgaagatttgtcaaattttgaaaattttgaagctaaatcaaaattt
aagtcaaaaataaatcgccatcccgagttgtttaataatttttaa

DBGET integrated database retrieval system