KEGG   Drosophila virilis: Dvir_GJ23012Help
Entry
Dvir_GJ23012      CDS       T01066                                 

Definition
GJ23012 gene product from transcript GJ23012-RA
Orthology
K06072  
deoxyhypusine monooxygenase [EC:1.14.99.29]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.29  deoxyhypusine monooxygenase
     Dvir_GJ23012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 302 aa AA seqDB search
MVSQEQIKAIGGVLNNKERPLKERFRALFTLKNIGGGAAIEAISKAFDDDSALLKHELAY
CLGQMQDTQAVEILSKVLQDTTQEPMVRHEAAEALGAIGQPEVLPILEKYKEDSVIEVAE
TCAIALDRVRWLQTGQQVDDNNPYASVDPSPPTAGTKSVEELKAIYLDAKHSLFDRYRAM
FSLRNLRTEPSVLALAEGLKDKSALFRHEVAFVLGQLQEPCSIPYLQENLEDRLENEMVR
HECAEALGAIATEECIQILNCYANDEKRVVKESCVIALDMCEYENSPEFQYADGLTKLDG
TK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggtatctcaggaacagatcaaagcaattggcggtgtgctgaacaataaggaacgaccg
cttaaggagcgcttccgtgcactgttcacattgaaaaatatcggcggaggggcagcaatt
gaggcaatcagcaaagcatttgatgatgattccgcgctgctgaaacacgaattggcctac
tgtttgggacagatgcaggacacgcaggccgtggaaatactcagcaaagtgctgcaggac
accacccaagagccgatggtgcgccatgaggctgccgaagcattgggcgccattggccaa
cctgaggttttgccaatactcgagaaatacaaggaggattcagttattgaagttgctgag
acttgcgccatagcgctggatcgtgtgcgctggctgcagaccggtcaacaggtggacgat
aataacccatacgcgtctgtggacccatctccgccaacagcaggcacaaagagcgtggag
gagctaaaggccatctatttggatgccaaacatagtctgttcgatcgctatcgcgccatg
ttcagtttgcgtaatctgcgcaccgagccgagcgttctggccctggccgagggacttaag
gataagtcggcattgttccggcacgaggtcgctttcgtcctgggtcagctacaggaacca
tgcagcataccgtatctgcaggagaacctggaagatcgcctcgagaacgaaatggtgcgt
cacgagtgtgccgaagcactgggcgccattgccaccgaggagtgcattcagatactgaac
tgttatgcgaatgatgagaaacgtgtcgtcaaggagagctgcgtcattgccctggacatg
tgcgagtacgagaacagcccagagtttcagtatgccgacggtctgaccaagctggatggc
actaagtga

DBGET integrated database retrieval system