KEGG   Drosophila virilis: Dvir_GJ23054Help
Entry
Dvir_GJ23054      CDS       T01066                                 

Definition
GJ23054 gene product from transcript GJ23054-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 594 aa AA seqDB search
MASATCLCSSKKESRVHVIYTGGSIGMMRNDAGALVAIKNELFNRLREYPCCHDKTYKQS
SENEDQWLVLPTVEGELRVLYDLDEYTSVTDSSCMNAKDWQRIANDVGDAYHRYDGFVIL
HGTDTMAYTASALAFLLENLGKPVVVTGAQLPIFDMRTDGRDNFIGSLMLAGNYNIPEVL
IVFGGRVLRGCRSTKVNPDSFHAFESPNHPFLGTIGANIDINGRKIFRSCNLGTFSLHTE
LEPNVGLLRIYPGITAAAVRAFLSEPMKGVVIQSFGVGNLPSNDDELMDEICKAVKRGVL
IVNISQCPKGSVSPINVAGTWMETGVISGCDMTQEAALTKLAYVLGKREWDFCNKKNMLE
VSLRGEMTTNKAAKINDIDFIEGVARTLHLSMSSERHQMCSIFFPALVEAAVRDDDVVKL
KNLRQYGANLSDTNTEGRTALHLACFLGKQDSVKCLLAEGSPVDLTDRFNRTPLHEAIDS
DNHEIIQLLLKKGAVLPEEPVELAEKLRSLTEHDRIERLESYRLAGANLDVVDGTGRSAL
HHACQLGKTDVVKYLLPFYENPSIKDSLGLGPIQYAKVGNHCDIVAMLCASKQN
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgccacatgtctgtgcagctcaaaaaaggaatcgcgtgtgcatgtcatctac
accggaggttctattggcatgatgcgcaatgatgcgggcgccttggtggccataaaaaat
gagttattcaaccgactgcgcgaatatccctgctgccacgataaaacctacaagcagtcc
agcgaaaatgaagatcagtggctggttttgccaacagtggaaggcgaattacgtgtgctg
tatgatttggatgaatatacgtcggtaacggactctagctgcatgaacgcgaaggactgg
caacgcatagccaacgacgtgggcgacgcctaccatcgatacgatggtttcgttatactg
catggaacggacaccatggcctatacggcctctgcgctggcttttttgctggagaatttg
ggtaaacccgttgtggttacgggcgcccagttacccattttcgatatgcgaacagatgga
cgggacaactttattgggtcgttgatgctggcgggcaactataacattcccgaggtgttg
atcgtttttggtggtcgggtgttgcgtggctgccgcagcacaaaggttaacccggactca
tttcatgcattcgaatcgcccaatcatccgtttctcggaacaattggcgcaaatatcgac
attaatggccgcaaaatatttagatcctgcaatctgggtaccttctcgctgcacacagag
ctggagcctaatgtgggtttgctgcgcatctatccaggcatcactgcagctgcagtgcga
gcctttctcagcgagcccatgaagggcgttgttatacagagctttggggtcggcaatttg
cccagcaacgatgacgaactcatggatgagatttgcaaggccgtcaaacgtggagtcctg
attgtgaatatatcgcaatgtccaaagggctcagtttctcccattaacgtggcgggcact
tggatggaaacgggcgtgatctcgggctgtgatatgacacaggaggctgcgttaacaaag
ttagcctatgtgcttggcaaaagggaatgggacttttgcaataaaaaaaatatgctggag
gtaagcttgcgcggcgagatgaccaccaacaaagcggcaaaaataaacgatattgatttc
attgagggcgtggcacgcacattgcatttatccatgtccagcgagcggcatcaaatgtgc
tccatattctttccggcgcttgtcgaggcagccgtcagggatgacgatgtggttaagttg
aaaaatctgcgacaatacggtgcaaacctcagcgataccaataccgagggacgcactgca
ctgcatctggcctgttttctgggcaaacaagacagcgtcaagtgcctgctggcagagggt
tctcccgtggacctgaccgatcgattcaatcggacgccactgcacgaagccatcgattcg
gataatcatgagattattcaactattgctaaagaagggcgctgtgctgccggaagagcca
gtggagttggcagagaaactgcgctccctgaccgagcatgaccgaatcgaacgtctagag
tcctatcgcttggcgggtgcaaatctagatgtagtcgacggcaccggtcgttcagcgctt
catcatgcatgccagctgggcaaaacagatgtggtgaaatatctgttgcccttttatgag
aatcccagtattaaggactcgctcggcctggggcctatacaatatgccaaggtgggcaat
cattgtgacattgtggccatgttatgtgcaagcaaacagaattaa

DBGET integrated database retrieval system