KEGG   Drosophila virilis: Dvir_GJ23165Help
Entry
Dvir_GJ23165      CDS       T01066                                 

Gene name
Dvir_Desat2
Definition
(RefSeq) desaturase 2
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
dvi  Drosophila virilis
Pathway
dvi01040  Biosynthesis of unsaturated fatty acids
dvi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dvir_GJ23165 (Dvir_Desat2)
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dvir_GJ23165 (Dvir_Desat2)
Lipid biosynthesis proteins [BR:dvi01004]
 Desaturase
  First
   Dvir_GJ23165 (Dvir_Desat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 6630251
NCBI-ProteinID: XP_002053765
FlyBase: FBgn0210267
UniProt: B4M0C3
Position
Unknown
AA seq 381 aa AA seqDB search
MPPNAITSPSNVLATCPEVEQLPSGECASTASSKQTGVLFEGDADTADCALDVDVKKLKK
AEKRKLKLVWRNIMLFGYLHLAAVYGGYLMLTQAKWATVVFSFFLYTAGMIGITGGAHRL
WAHRSYKAKWPLRVILVTFNTIAFQDAAFHWARDHRVHHKFSETDADPHNATRGFFFSHV
GWLLCKKHPDVVAKGKSLDVTDLRADRILMFQLKHYFVLMPLACFILPTIIPMICWNESL
LCSWFVATMFRWCFQLNMTWLVNSAAHKFGGRPYDKNINPSQSPYVSAFTFGEGWHNYHH
VFPWDYKTAEWGRYSLNMTTAFIDFFAKIGWAYELKSVAPETIERRVRRTGDGTHELWGW
GDKDLTAEDAQHVLFVDKKAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaacgctataaccagcccgtccaatgtgctggccacatgccccgaggtggag
cagctgccgagcggcgagtgtgcatcgacggcttcttccaagcagaccggtgtgctcttt
gaaggtgatgcggatactgcagactgtgctttggatgtggatgtaaaaaagttgaaaaag
gccgagaaacgcaaattgaaattggtttggcgcaacataatgctcttcggctatttacat
ttggcagctgtctacggcggctatttgatgttaacccaggccaaatgggccacagttgtc
ttctcatttttcctatatactgcgggcatgattggcattacaggcggcgctcatcgtctc
tgggctcatcgctcctacaaggctaagtggccgttgcgcgtgattttggtcaccttcaat
acgattgcctttcaggatgccgcctttcattgggcgcgcgatcatcgtgtgcatcacaag
ttctccgaaacggatgccgatccgcataatgcgacacgtggcttcttcttctcgcacgtc
ggctggctgctatgcaagaagcatcccgatgtggtcgccaagggcaagagcctggatgtt
accgatctgcgcgccgatcgcatactcatgttccagctcaaacactactttgtgctaatg
ccactcgcctgcttcatattgcccaccatcatacccatgatttgctggaacgagtcgttg
ctgtgctcctggtttgtggccaccatgttccgctggtgcttccaactgaacatgacctgg
ttggtgaacagtgccgcacacaagttcggtggccggccttatgacaagaacattaatccc
tcacaaagtccatacgtgtcggcattcaccttcggcgaaggctggcataactatcatcat
gtctttccctgggactataagacggctgagtggggcagatattcgctgaacatgaccaca
gcattcatcgatttcttcgccaagatcggttgggcctatgaactgaagtcggtggcgccg
gagaccattgagcggcgagtgcgtcgcactggcgatggaacacacgagctgtggggctgg
ggcgacaaggatctaaccgcagaggatgcacagcatgtgctgttcgttgacaagaaggca
gcatag

DBGET integrated database retrieval system