KEGG   Drosophila virilis: Dvir_GJ23166Help
Entry
Dvir_GJ23166      CDS       T01066                                 

Definition
GJ23166 gene product from transcript GJ23166-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dvi  Drosophila virilis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dvi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dvi01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 384 aa AA seqDB search
MPPNATAGGQSITDSLISAAATAAAESEQNPTKLQQDSTGVLFECDAETIDGGLVKDIVS
MKKADRRKLKLVWRNIILFGYLHLAALYGAWLIFTSAKWQTIALAFVLYAVSGLGITAGA
HRLWAHRSYKAKWPLRVILVIFNTVAFQDAAFHWARDHRVHHKYSETDADPHNATRGFFF
SHIGWLLCKKHPEVKAKGKGVDLSDLRADPVLMFQKRHYMILMPLACFILPTLAPMYFWN
ETLMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDRFINPSENISVALLAFGEGWHN
YHHVFPWDYKTAEFGKYSLNLTTAFIDFFAKIGWAYDLKSVSPDIIKKRVKRTGDGTHAT
WGWGDKDQPKEEIDDAVITHKKSE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaacgcaaccgccggagggcagtcgattaccgactcgctaatctcggccgct
gccacagcagccgccgaatcggagcagaatcccaccaagctgcagcaggattcgaccggt
gtgctgttcgagtgcgatgccgagaccatcgatggcggccttgtcaaggatattgtctcc
atgaaaaaggccgacaggcgcaaactgaaactcgtctggcgcaatataatactctttggc
tatttgcacttggccgcactctacggcgcttggctgatcttcacctcggccaaatggcag
acaattgctttggctttcgttctttatgctgtctctggcttgggcattacggctggcgct
catcgtctgtgggcccatcgttcgtacaaggctaagtggccgttgcgcgtgattttggtg
atattcaatacggtggccttccaggatgccgctttccattgggctcgcgatcatcgtgtg
catcacaagtattcggaaaccgatgccgatccgcacaatgcgacacgtggcttcttcttc
tcgcacattggctggctgctgtgcaagaagcatcccgaggtgaaggccaagggcaagggt
gttgatctgtccgatctgcgcgccgatcccgtcctgatgttccagaagagacactacatg
attctgatgcccctggcctgtttcattctgccgactttggcgcccatgtacttctggaat
gagaccttgatgaatgcctggtttgtggccaccatgttccgctggtgcttcattctgaat
gtgacctggctggtgaatagtgctgcgcacaaattcggtggccgtccctatgacagattc
atcaatccttcggagaacatttctgttgcgttgctcgctttcggcgagggctggcataac
tatcatcatgtgttcccctgggactacaagaccgctgagtttggcaaatattcgctaaat
ctgaccacggccttcattgatttctttgccaagattggctgggcctacgatctaaagagc
gtctcccccgacattatcaagaagcgtgtgaagcgcaccggcgatggcacccacgccacc
tggggctggggcgataaggatcagccaaaggaggagatcgatgatgccgtgattacacac
aaaaagagcgaataa

DBGET integrated database retrieval system