KEGG   Drosophila virilis: Dvir_GJ23212Help
Entry
Dvir_GJ23212      CDS       T01066                                 

Definition
GJ23212 gene product from transcript GJ23212-RA
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEVDLVTA
KEQLEKANTELEEKEKLLTSTESEVATLNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAE
QAEKQVKRLQKEVDRLEDRLFHEKEKYKAICDDLDQTFAELTGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataatgccattgat
aaggcagatacctgcgagaatcaagccaaggatgccaactcccgcgccgacaaactgaat
gaggaggtgcgcgatttggagaagaaatttgtgcaggttgaggtcgatttggtcaccgcc
aaggagcagctggagaaggccaataccgaattggaagagaaggagaaactgttgacctcc
acggaatccgaggtggccaccttgaaccgtaaggtccaacagattgaggaagatttggag
aaatctgaggagcgctcaacaaccgcacaacagaagctgttggaggccacacaatcggcc
gatgagaacaaccgcatgtgcaaagtattggagaatcgttcccagcaggatgaggagcgt
atggatcagttgaccaaccaactgaaggaagcccgcatgctcgctgaggacgccgatacc
aagtccgatgaagtgtcccgcaagctggccttcgttgaagatgagctggaagtggctgag
gatcgtgtccgctccggtgaatccaagatcatggagctggaggaagagctgaaggttgtc
ggcaactcgctgaaatctctggaagtgtccgaggagaaggccaaccagcgcgtcgaggaa
ttcaagcgcgagatgaagaccttgtccatcaagttgaaggaagccgaacagcgcgccgag
caagccgagaagcaagtgaagcgcctgcagaaggaggtcgacaggctagaagaccgtctc
ttccatgagaaagaaaaatacaaagcaatctgcgacgatttggaccagacatttgctgaa
cttactggatattaa

DBGET integrated database retrieval system