KEGG   Drosophila virilis: Dvir_GJ23212Help
Entry
Dvir_GJ23212      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform C
  KO
K10374  tropomyosin 2
Organism
dvi  Drosophila virilis
Brite
Cytoskeleton proteins [BR:dvi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     Dvir_GJ23212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 DUF745 ATG16 MscS_porin Laminin_II ERM EzrA CLZ DUF1664 Reo_sigmaC DUF4200 BicD FPP Alanine_zipper BST2 Spc7 Cep57_CLD_2 AAA_13 ORF6C TTKRSYEDQ Uds1 BCL_N Fez1 DUF724 WEMBL BLOC1_2 LPP TPR_MLP1_2 Golgin_A5 DUF3450 DUF4472 APG6 FUSC SlyX Lebercilin CENP-F_leu_zip HOOK Laminin_I Polysacc_deac_2 T3SSipB FlaC_arch IFT57 Fib_alpha DUF3584
Motif
Other DBs
NCBI-GeneID: 6630098
NCBI-ProteinID: XP_002053691
FlyBase: FBgn0210314
UniProt: B4LZY3
Position
Unknown
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEVDLVTA
KEQLEKANTELEEKEKLLTSTESEVATLNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAE
QAEKQVKRLQKEVDRLEDELGINKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataatgccattgat
aaggcagatacctgcgagaatcaagccaaggatgccaactcccgcgccgacaaactgaat
gaggaggtgcgcgatttggagaagaaatttgtgcaggttgaggtcgatttggtcaccgcc
aaggagcagctggagaaggccaataccgaattggaagagaaggagaaactgttgacctcc
acggaatccgaggtggccaccttgaaccgtaaggtccaacagattgaggaagatttggag
aaatctgaggagcgctcaacaaccgcacaacagaagctgttggaggccacacaatcggcc
gatgagaacaaccgcatgtgcaaagtattggagaatcgttcccagcaggatgaggagcgt
atggatcagttgaccaaccaactgaaggaagcccgcatgctcgctgaggacgccgatacc
aagtccgatgaagtgtcccgcaagctggccttcgttgaagatgagctggaagtggctgag
gatcgtgtccgctccggtgaatccaagatcatggagctggaggaagagctgaaggttgtc
ggcaactcgctgaaatctctggaagtgtccgaggagaaggccaaccagcgcgtcgaggaa
ttcaagcgcgagatgaagaccttgtccatcaagttgaaggaagccgaacagcgcgccgag
caagccgagaagcaagtgaagcgcctgcagaaggaggtcgacaggctagaagacgagctg
ggcatcaacaaggacagatacaagtctctggccgacgagatggactccacgttcgccgaa
ttggctggctattaa

DBGET integrated database retrieval system