KEGG   Drosophila virilis: Dvir_GJ23225Help
Entry
Dvir_GJ23225      CDS       T01066                                 

Definition
GJ23225 gene product from transcript GJ23225-RA
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dvi  Drosophila virilis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dvir_GJ23225
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dvir_GJ23225
Glycosyltransferases [BR:dvi01003]
 Polysaccharide
  Storage polysaccharide
   Dvir_GJ23225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 710 aa AA seqDB search
MLRRQMSYRFEDQDSSSMALRMNRRFSRVESGTDLKDYFDRGDNASRENRWNFEVAWEVA
NKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEIEFPRGNPLLDAVNTLRS
RGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCNIGVPHLDIETNDAIILGF
MIAEFLEEFRNCAIAFSQNNDLNPPRIVAHFHEWQAGVGLIVLRTRLIEIATVFTTHATL
LGRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCMERGATHLAHVFTTVSEITGYEAEH
LLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHMDFDLDKTLYFFI
AGRYEFGNKGADIFIEALARLNAMLKHERPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQ
LRDTINNVQQAVGKRMFDTCVKGHIPSPDELLQKDDLVKIKRCMYAMQRDSMPPVTTHNV
ADDWNDPVLSSIRRCHLFNSVHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSY
YEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHISDPKSYGIYIVDRRYIGLENSVQQLS
SFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDESSAYG
SRSNLIFSRPQSEPPSPTSSRHTTPAPSLHGSDDEDSVDEETELKELGIK
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgttgcggcgccaaatgtcctatcggtttgaagatcaagattcctcgtctatggctttg
cggatgaatcgtcgattttctcgggtggagtccggcacggatctgaaggattacttcgat
cgcggcgataatgcatcgcgcgagaatcgctggaactttgaggtcgcctgggaagtggcc
aacaaggttggcggcatttataccgtgatacgctccaaggcctatgtgtccacagaggag
atgggcgagcagctgtgcatgatgggcccctacaaggaacattgtgcacgcaccgaaatg
gaggaaattgaatttccacgtggcaatccgctgctggatgcggtcaatacgttacgctcg
agaggctacaaaattcacaccggtcggtggctcgtcgatggcaatccccagttgatactg
tttgacattggctctgctgcctggaaattggatcagttcaagtccgagatgtgggagaag
tgtaacattggcgtaccccatttagatatagagacgaacgatgccattattctaggcttc
atgattgctgagtttctagaggagttccgcaactgtgccatcgccttctcccagaacaat
gatttgaacccaccgcgcattgtcgcccactttcatgagtggcaggccggcgtgggtctg
atagtgttgcgcacacgactcattgagatcgctaccgtgttcaccacgcatgccactctc
ctgggtcgctacctgtgcgctggcaacaccgatttctacaacaatctcgacaagtttgct
gtggatgaggaggccggcaagcgtcaaatctatcatcgctattgcatggagcgtggcgcc
acgcatttggcgcatgtctttaccactgtctcggaaatcacaggctacgaggcggagcat
ctgctcaaacgtaagccagacatcataacgcccaatggcctgaatgtcaaaaagttttcg
gccattcacgagttccagaatttgcatgccgttgccaaggagaagatcaatgagtttgtg
cgcggtcatttctatggccacatggactttgacctggataagacgctgtacttcttcatt
gctggtcgttatgagtttggcaataaaggcgccgatatattcatcgaggcgctggctcgt
ttaaatgcgatgctgaagcacgagcgtcccgataccactgtggtggccttccttatcttt
cccaccaagacgaacaactttaatgttgattcgctgcgtggtcatgcagtcatcaagcag
ctgcgcgataccatcaacaacgtgcagcaggcggtgggcaagcgcatgttcgacacatgc
gttaagggtcacatacccagccccgacgagcttttgcagaaggatgatctggtgaagata
aagcgttgtatgtatgccatgcagcgtgattcaatgccgccggttaccacgcacaacgtg
gctgatgattggaacgatccggttctatcttcaatcaggcgctgtcatttattcaattcg
gttcacgatcgtgtcaaaatggtctttcatccggagtttttgacatcgacgaatccactg
ttcggcatcgattacgaggaatttgtgcgcggctgccatttgggcgtgttcccatcttac
tacgagccctggggctatacacccgccgagtgtacagtgatgggcataccaagtgtaacc
acaaatctgtcgggtttcggttgtttcatgcaggagcacatcagcgatcccaaatcctat
ggcatctacattgttgatcgtcgctatattggtttggagaacagcgtacagcagttgtcc
agctttatgatggagttctcacgtctgaatcgccgccaacgcatcattcaacgcaatcgc
acggagcggctcagcgatctgcttgactggcgtacgctgggcatttactacagacaggct
agggtgaaggccttgcaggccgtctatcctgattatgtggatgagagctctgcgtatggt
tcacgcagcaatttgatcttctcacgcccacaaagcgaaccgcccagtcccacatcttcg
cgacacaccacaccagcgccatcgctgcatggctccgatgatgaggattcggttgatgag
gaaactgagctgaaggaactgggcattaagtaa

DBGET integrated database retrieval system